CAZyme Information: MGYG000000922_02195

Basic Information

• Species: UMGS416 sp900542005
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; UMGS416; UMGS416; UMGS416 sp900542005
• CAZyme ID: MGYG000000922_02195
• CAZy Family: CE15
• CAZyme Description: Carbohydrate esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
344		38552.95	6.1699

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000922	2901170	MAG	China	Asia

• Gene Location: Start: 6387; End: 7421 Strand: +

Full Sequence      

MLKKKVEALQLPTAKARRDMLELLYSQEYGFPPPAPERVWAEELACNENAWAGKAVEKRM
QLWVETSQGRAGFPFCLTIPKKQMRPMAAVFLSFERAIPNRYYPAEEMVDEGLAVACLCY
EDVACDRDDGFQEPLPRLLRSGPQPGDGWGKLSLWAWAASRVADYLTTLPELDTDNLAVL
GHSRLGKTALLAAAGDERFTFVMSNDSGCSGAALARGTHGETVEDICARFPYWFCPNYQA
YRGREGAMPFDQHFLLKAIEPRYVYVASAAQDAWADPAQEYLACVAAGGMIHPDRMPECG
DAFIEGRLGYHMREGGHFLSRYDWAGFIRFMRAHRRQTGKAKEG

Enzyme Prediction     

No EC number prediction in MGYG000000922_02195.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE15	16	334	2.2e-59	0.9033457249070632

CDD Domains     

MGYG000000922_02195 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE95892.1	6.29e-115	15	335	31	361
ALL53565.1	9.79e-81	15	334	32	358
QOV20253.1	3.91e-80	17	334	35	358
AEV29352.1	1.67e-75	14	334	26	368
QDV85039.1	3.20e-73	15	330	83	416

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GRY_A	7.66e-58	13	333	33	394	GlucuronoylEsterase from Solibacter usitatus. [Candidatus Solibacter usitatus]
6GRW_A	2.66e-56	103	330	155	392	GlucuronoylEsterase from Opitutus terrae (Au derivative) [Opitutus terrae PB90-1],6GS0_A Native Glucuronoyl Esterase from Opitutus terrae [Opitutus terrae PB90-1]
6SYU_A	4.08e-56	103	330	173	410	Thewild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with xylobiose [Opitutus terrae],6T0I_A The wild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with the aldotetrauronic acid XUX [Opitutus terrae]
6SYR_A	5.90e-56	103	330	184	421	Thewild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with D-glucuronate [Opitutus terrae PB90-1]
6SYV_A	1.13e-55	103	330	173	410	Theglucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with D-glucuronate [Opitutus terrae PB90-1],6SZO_A The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with D-galacturonate [Opitutus terrae PB90-1],6T0E_A The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with benzyl D-glucuronoate and D-glucuronate [Opitutus terrae PB90-1],6T0E_B The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with benzyl D-glucuronoate and D-glucuronate [Opitutus terrae PB90-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0K2VM55	1.19e-47	49	342	141	432	Carbohydrate esterase MZ0003 OS=Unknown prokaryotic organism OX=2725 GN=MZ0003 PE=1 SV=1
G0RV93	2.52e-15	150	290	243	390	4-O-methyl-glucuronoyl methylesterase OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=cip2 PE=1 SV=1
B2ABS0	3.57e-15	17	274	145	391	4-O-methyl-glucuronoyl methylesterase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=ge1 PE=1 SV=1
P0CT87	1.27e-11	152	277	251	385	4-O-methyl-glucuronoyl methylesterase 1 OS=Phanerochaete chrysosporium (strain RP-78 / ATCC MYA-4764 / FGSC 9002) OX=273507 GN=e_gw1.18.61.1 PE=1 SV=1
A0A1D8EJG8	1.32e-11	146	274	269	406	4-O-methyl-glucuronoyl methylesterase 1 OS=Sodiomyces alcalophilus OX=398408 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000922_02195.