CAZyme Information: MGYG000000923_00128

Basic Information

• Species: Phocaeicola sp900552645
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900552645
• CAZyme ID: MGYG000000923_00128
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
777	MGYG000000923_1|CGC2	86668.12	5.3247

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000923	2732014	MAG	China	Asia

• Gene Location: Start: 136867; End: 139200 Strand: +

Full Sequence      

MKRLFLSMIMCATGLLPMAAQQVKPAIPSDPDIEAKIQKRLKTMTLEEKIGQMCEITVDS
VTDMQKRDKFTVNKKMVDKVIGQYKVGSILNVPFSIAQPKEVWADLIKTLQDKSMETMGI
PCIYGVDQIHGTTYTRGGTFFPQGINMAASFNRDLMKKSSEISAYETKAGCIPWTYAPVM
DLGRDPRWSRMWESYGEDPYVNQEMAVASLKGFQGDNPNKIGPNNVAACIKHFMGYGVPV
SGKDRTPSSISRADMREKYFAPFLACIKEGALSLMVNSGVDNGMPFHANKELLTEWVKND
LNWDGMIVTDWADINNLCTRDHIAATKKEAIKIAINAGIDMSMVPYELSFCDDLKELVQE
GEVPMSRIDDAVARVLRLKYRLGLFENPYWDIKKYDRFASAQSAAVALQAAEESEILLKN
QDNILPIKKGEKILLAGPNANSMRCLNGGWSYSWQGDRADDCAQEYNTIYEALCNKYGKS
NIIYEPGVTYKTAGGSEWWEENTPEIQKAVNAAAKADVIIACIGENSYCETPGNLNDLTL
SRNQIDLVKALAATGKPIVMVLNEGRPRIINEIEPLAKAVVDILLPSNYGADALANLLAG
DANFSAKLPFTYPHHINSLATYDYKPCENMGQMAGNYNYDAVMDVQWPFGYGLSYTDYKY
DNFKVDKSNFNADDDLTFTVDVTNTGKMEGKESVLLFSRDLVASSTPDNKRLRNFEKVSL
KPGETKSVTMKIKGSDLAFVNYYGKWTLEKGDFIMTCGNQTLPLVCTQTKVWDTPNR

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	115	344	1.4e-65	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	3.93e-149	1	753	1	746	beta-glucosidase BglX.
COG1472	BglX	1.93e-77	44	460	1	380	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	3.80e-70	45	378	1	316	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	2.28e-64	136	759	109	770	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	1.06e-46	416	655	2	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY36471.1	0.0	1	777	4	782
ADY35485.1	0.0	1	777	4	782
QRM99675.1	0.0	2	777	5	781
QUT79256.1	0.0	2	777	5	781
QDM10337.1	0.0	2	777	5	781

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	0.0	21	777	1	759	Bacteroidesovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
5TF0_A	1.03e-107	29	761	5	740	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
5XXL_A	3.53e-107	18	761	1	741	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	1.89e-106	18	761	1	741	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
6R5P_A	5.61e-98	12	758	11	751	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5P_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXU3	0.0	2	777	5	781	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
Q23892	8.15e-154	37	764	80	818	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
Q56078	2.90e-107	10	758	4	751	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	2.18e-106	10	761	4	754	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH0	8.63e-97	1	758	1	707	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.005259	0.980109	0.013809	0.000325	0.000238	0.000223

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000923_00128.