CAZyme Information: MGYG000000923_00416

Basic Information

• Species: Phocaeicola sp900552645
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900552645
• CAZyme ID: MGYG000000923_00416
• CAZy Family: GT101
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
303	MGYG000000923_1|CGC6	35618.38	9.395

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000923	2732014	MAG	China	Asia

• Gene Location: Start: 448434; End: 449345 Strand: +

Full Sequence      

MKRILVNIWNNSYDIFIHVKNYFYVSIDSIYGRIHNPPKIMSIEDTIQYIKDNKCSVSRL
GDGEIKIACGKDLAFQRANTQIRMRMIEVMSVPIKNHIVCLPDIFKDLSCYNDEAYNHWK
LHLAYYRKYWYKHIDRRRLFYNAFISRCYMMFIDKSRSEEYFKNIKGIWENRNVLLIEGE
KSRLGVGNDLFDNVSSIRRILAPNKNAFDYYDSIVTKIIELAPYSYLLLLAIGPTATVMS
YDLAKKGYQAVDIGHIDIEYEWLRMKALQKKPVKDKFVNEAGAGKGVGESNDIKYLKEII
CRF

Enzyme Prediction     

No EC number prediction in MGYG000000923_00416.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT101	57	280	4.1e-81	0.9955357142857143

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR03728	glyco_access_1	4.66e-99	40	302	1	263	glycosyltransferase, SP_1767 family. Members of this protein family are putative glycosyltransferases. Some members are found close to genes for the accessory secretory (SecA2) system, and are suggested by Partial Phylogenetic Profiling to correlate with SecA2 systems. Glycosylation, therefore, may occur in the cytosol prior to secretion.
pfam08759	GT-D	3.10e-97	58	281	1	223	Glycosyltransferase GT-D fold. This domain is found at the C-terminus of proteins such as the probable glycosyltransferase Gly that also contain the glycosyl transferase domain at the N-terminus. It is also found N-terminal in numerous putative glycosyltransferases such as GalT1. GalT1 has been shown to catalyze the third step of Fap1 glycosylation. This domain is structurally distinct from all known GT folds of glycosyltransferases and contains a metal binding site. This new glycosyltransferase fold has been named GT-D.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AND20327.1	3.26e-138	1	303	1	303
AII62858.1	3.26e-138	1	303	1	303
QNG58483.1	2.27e-98	1	299	6	303
QQA15849.1	5.93e-91	1	299	6	303
QWI40596.1	5.93e-91	1	299	6	303

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PFX_A	1.34e-61	39	302	13	275	Thehighly conserved domain of unknown function 1792 has a distinct glycosyltransferase fold [Streptococcus parasanguinis FW213]
4PHR_A	1.34e-61	39	302	13	275	Domainof unknown function 1792 (DUF1792) with manganese [Streptococcus parasanguinis FW213]
4PHS_A	2.99e-60	39	302	13	275	Selenomethioninesubstituted structure of domain of unknown function 1792 (DUF1792) [Streptococcus parasanguinis FW213]
5V4A_A	1.71e-55	40	300	8	268	ANew Glycosyltransferase (DUF1792) from Streptococcus sanguinis [Streptococcus sanguinis SK36],5V4A_B A New Glycosyltransferase (DUF1792) from Streptococcus sanguinis [Streptococcus sanguinis SK36]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9AEU2	1.20e-49	40	300	417	676	Probable glycosyl transferase Gly OS=Streptococcus gordonii OX=1302 GN=gly PE=3 SV=2
A0A0H2URB1	5.99e-48	39	302	549	811	Glycosyltransferase GlyD OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000923_00416.