CAZyme Information: MGYG000000923_00780

Basic Information

• Species: Phocaeicola sp900552645
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900552645
• CAZyme ID: MGYG000000923_00780
• CAZy Family: GH97
• CAZyme Description: Retaining alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
648	MGYG000000923_2|CGC5	73770.61	6.274

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000923	2732014	MAG	China	Asia

• Gene Location: Start: 224929; End: 226875 Strand: +

Full Sequence      

MKKHLFTGLSFLFALSSLAQETTVTSPDSNLKVDVNVKNGIPVYSVSYKEKTILEDSPLG
VIANIGDFSKNIEWISNDNKKVNKLYKQDRIKKSEIHYEANQLSYNVKNSEGKTLQIEFM
VSNNDIAFRYNFPKYGETASIRIEKENSGFRFPSFTTTFMCPQSDAMIGWKRTKPSYEEE
YKADEPLNTPSKFGHGYTFPCLFHIGDNGWALVSETGVDSKYCGSHLSDSDGNGTYSIAF
PMAEENNGNGTVAPGFSLPGSTPWRTITVGSNLKPIVETTIPWNITEPSYKSENDYKFGR
GTWSWILWQDGSINYEDQVKYIDLAAAMGYEYVLVDNWWDKNIGRSKMEELIKYAQSKKV
DVFLWYSSSGYWNDIEQGPINYMDNSIIRKKEMRWMKEQGVKGIKVDFFGGDKQETIRLY
ESILSDADDNGLMVIFHGCTIPRGWERMYPNYVGSEAVLASENLIFNQHYCDEEAFASTL
HPFIRNTIGCMEYGGVFLNKRMDKSNKKGNIRRTTDGFQIATAVLFQNPIQNFTIAPNNL
TDASEIALDFMKKIPTTWEDIKFIDGYPGKYSVLARKHGGKWYIAGINALKEPLKLKLDL
SMLNKGEKVILYNDNRKLELVKEEITIKKPQQVEITLQPEGGMIITQN

Enzyme Prediction     

EC	3.2.1.22	3.2.1.88

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	12	645	2.5e-177	0.9889064976228209

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10566	Glyco_hydro_97	1.72e-88	297	555	6	278	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14508	GH97_N	1.00e-70	26	288	1	235	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam14509	GH97_C	5.80e-20	558	645	1	94	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.
cd11573	GH99_GH71_like	0.003	383	453	7	81	Glycoside hydrolase families 71, 99, and related domains. This superfamily of glycoside hydrolases contains families GH71 and GH99 (following the CAZY nomenclature), as well as other members with undefined function and specificity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABR38697.1	0.0	1	647	1	647
QEW34830.1	0.0	7	647	2	642
QQY40359.1	0.0	7	647	2	642
QQY44785.1	0.0	7	647	2	642
QJR79277.1	0.0	7	647	2	642

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XFM_A	0.0	20	644	15	639	Crystalstructure of beta-arabinopyranosidase [Bacteroides thetaiotaomicron],5XFM_B Crystal structure of beta-arabinopyranosidase [Bacteroides thetaiotaomicron],5XFM_C Crystal structure of beta-arabinopyranosidase [Bacteroides thetaiotaomicron],5XFM_D Crystal structure of beta-arabinopyranosidase [Bacteroides thetaiotaomicron]
3A24_A	1.74e-46	26	645	6	638	Crystalstructure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron],3A24_B Crystal structure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron]
5E1Q_A	1.79e-45	26	645	20	652	Mutant(D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482],5E1Q_B Mutant (D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482]
3WFA_A	3.37e-35	24	610	5	657	Catalyticrole of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron],3WFA_B Catalytic role of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron]
2JKA_A	3.39e-35	24	610	14	666	Nativestructure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKA_B Native structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKE_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKE_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKP_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482],2JKP_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8A6L0	9.48e-49	1	645	1	659	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
D7CFN7	1.25e-48	25	586	44	561	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1
G8JZS4	1.05e-35	1	610	1	677	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000437	0.998532	0.000441	0.000197	0.000186	0.000181

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000923_00780.