CAZyme Information: MGYG000000923_01032

Basic Information

• Species: Phocaeicola sp900552645
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900552645
• CAZyme ID: MGYG000000923_01032
• CAZy Family: CBM9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
681		79225.02	6.3684

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000923	2732014	MAG	China	Asia

• Gene Location: Start: 126307; End: 128352 Strand: -

Full Sequence      

MKKSFRIIILLLLSTITVQAQNLYKKYERVLTQPRMYTCYRTSDNLKIDGKLNEKGWKDA
PFTESFVDISGEGFAEPKYDTKAKMLWDDNYLYVGALLEEDDIKAKLTKRDTIIYYDNDF
EVFIDPDGDGHNYFEIETNARGVVFDLMLDKPYRSGGNFMVQWDCPGLKLAIHRDGTLNK
GKDKDKYWSVEMAIPREALTMNFNNTLKAGNCWRINFSRVQWLKEKGPEENWVWSPTGKI
DMHMPDRWGYLYFSDKTVGSGTDNIKLPYSEGIYKLIWSMFYAQQDNYACKKSYIKSIKG
FDLTSEELNSIPANAKIDIEATNKTYVISISDPENSVVYYINNEGRFWSSKLEPREVKNW
VWTGINSHKDAKDWKEWFSLLKECGISAVLFGGYNEDIFKMCKEAGLEAHQWIWTMNRGE
VRNTHPDWFAVNRNGESCYDKPPYVKYYNFICPNHPGVASYLTNDYVTAAHKPYVDGVHL
DYVRMPDVILPVGLWKNYRIEQKEEYPQYDYCYCDVCRSLFKKQTGKDPMEIEHPMENQS
WLNFRLNSITKVVDSITTAVKKDNKFISAAVFPGPTMAKKMVRQDWGNWSLDAYFPMIYN
KFYLEEVDWIGESVKESVQTVNGKAKIYAGLMFGDIKDDFEAALDAAFDNGASGVSFFDG
PNTEYLKKFKTYLEKRNFKVK

Enzyme Prediction     

No EC number prediction in MGYG000000923_01032.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM9	48	251	4.9e-41	0.9835164835164835

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09620	CBM9_like_3	1.76e-77	48	250	1	200	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily may co-occur with various other domains.
cd09618	CBM9_like_2	3.32e-28	37	220	2	170	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized subfamily are typically found at the N-terminus of longer proteins that lack additional annotation with domain footprints.
COG1649	YddW	1.16e-16	392	659	112	368	Uncharacterized lipoprotein YddW, UPF0748 family [Function unknown].
cd09619	CBM9_like_4	1.21e-08	48	201	4	143	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
cd00241	DOMON_like	2.04e-08	77	200	16	128	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR73538.1	0.0	9	681	8	679
QJR69205.1	0.0	9	681	8	679
QJR64941.1	0.0	9	681	8	679
AND21566.1	0.0	9	681	8	679
QUT85170.1	0.0	9	681	8	679

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000503	0.998718	0.000228	0.000180	0.000181	0.000169

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000923_01032.