CAZyme Information: MGYG000000923_01159

Basic Information

• Species: Phocaeicola sp900552645
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900552645
• CAZyme ID: MGYG000000923_01159
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
910	MGYG000000923_4|CGC1	106939.54	4.7906

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000923	2732014	MAG	China	Asia

• Gene Location: Start: 18953; End: 21685 Strand: +

Full Sequence      

MFVCNLIHFNMNKRVNCYIPYIKDHTISLVKDLQKSPLTNKVIILFKTLGEDQPDEIKEL
KKYCHVMTVDSLISHDTYKRILNHSSRDYILIQTKETPIKIEYNTIKQMYQYCVGSDSGM
VYSDYYKISDNKKEKNPVIDYQLGSFRDDFDFGPLVMINRAFYKKSLNKTLRLGTTTNKY
SGFYELRLFLSLNYDLFHIKEYLYSEIENDNRLSNEKQFDYVNPSNIEVQKEREVIFNQF
LYNTFGKLYNNYPELEFNDNSFPTKASIIIPVKNRVKTIKDAIKSALNQETNFPFNIIVI
DNHSTDGTTEAIKEFNDERIIHIIPESDSLEIGGCWELAVNDKRCGIFSVQLDSDDIYSS
NNTLQKIIDKFEEEKCGMVIGTYSITDFNLNPLPPGIIDHKEWTEENGMNNALRINGLGA
PRAFYTPILRTIGIPNVSYGEDYALGLKISRFYKIARIYDVLYLCRRWEGNSDAALSVEK
LNINNIYKDSLRTLEIRERIKRNLKSEYSSRHSLNTYSINYSEDGIYEDNEDYIYYKDDD
DDYEYYDEEEDDDDDDDYEYYDEEDDDEPNPFDSIPSLLKAQIKNWDLAKENYSLLKEIR
SKKARMTSYYNFRIQYNPKRITSNLAKVDKQSIEERKCFLCNANRPSQQDKIEIELNREY
DICVNPYPILNDHLTLISKEHIPQEIDFTVIKDMRTFALYMNDYVIFFNGAQCGASAPDH
LHYQAVKKKDVPLYDYINKYNHIFDEDELDYLYEEENENEKEIKIGSNKYTTRYSVSLDC
TIQFIKKYPTTAFYIKDDSSLLGPEYIIHVINTLEKEGIDRNMYNILAWYEHLMDEYVTI
IIPRSKHRPDCYYAEGEDKIMVSPGALDMAGIIVTTSENDYKKMDHKKIKSIIQEVGIDI
NIGKQLFKSI

Enzyme Prediction     

No EC number prediction in MGYG000000923_01159.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	267	396	8.1e-17	0.7529411764705882

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16269	DUF4922	6.20e-58	691	899	2	183	Domain of unknown function (DUF4922). This family consists of uncharacterized proteins around 310 residues in length and is mainly found in various Bacteroides and Parabacteroides species. Several members are annotated as putative glycosyltransferases, but the specific function of this family is still unknown.
cd00761	Glyco_tranf_GTA_type	1.02e-14	268	382	1	114	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd06433	GT_2_WfgS_like	9.63e-14	267	381	1	111	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	3.30e-13	267	382	1	114	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG1215	BcsA	2.61e-10	235	462	26	261	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AND20203.1	5.30e-244	11	906	1	812
QUT83514.1	5.30e-244	11	906	1	812
QJR63544.1	6.00e-243	11	906	1	812
QJR67806.1	6.00e-243	11	906	1	812
QJR72142.1	6.00e-243	11	906	1	812

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000923_01159.