CAZyme Information: MGYG000000923_01341

Basic Information

• Species: Phocaeicola sp900552645
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900552645
• CAZyme ID: MGYG000000923_01341
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
508	MGYG000000923_5|CGC2	59193.02	7.8383

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000923	2732014	MAG	China	Asia

• Gene Location: Start: 39683; End: 41209 Strand: -

Full Sequence      

MNCRTFLFMSVLSFQLTGYGQINDLPMKEGKFKATDESLSQYQYPEWFQDAKFGIWAHWG
PQAVPRAGDWYAKLMYVPEKEKNQWYGNTDYIHHLEHYGHPTVKGYKDIIPLWKAERWDP
DKLMKLYKRVGAKYFVSMATHHDNFFLWNSKLHRWNSVNMGPKKDVVGLWQAAAKKEGLH
FGVSEHLAASYTWFQTAHGCDKNGPKKGIPYDGNNPEYQDLYHERALYGDDGWLTVNPKW
QREWYDRIKELVDNYKPELLYSDCGLPFENVGRSMIAHYYNQSLDKNSNPTVVYTCKEES
NGRFARDVERGVIEGISKYPWQTDTSIGDWFYRQGQKYMTSDEIIQMLVDIVSKNGNLLL
NVVQTPEGDLEDDVIKILEEIAIWTKDNGEAIYGTRPWNIYGEGPSMNDKQEKGTFGGLK
DIRSYKSGDIRFTQKKDVLYAFSMEKGDRNINIHSLGYDSNNKKVKSVRMLGSDKKIKWI
QKDDALIITNPEVMPSYKTVVFEIKFRK

Enzyme Prediction     

No EC number prediction in MGYG000000923_01341.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	25	394	1.5e-101	0.9393063583815029

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00812	Alpha_L_fucos	2.97e-119	26	456	1	384	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam01120	Alpha_L_fucos	4.30e-114	30	390	4	333	Alpha-L-fucosidase.
COG3669	AfuC	1.15e-84	58	445	1	368	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam16757	Fucosidase_C	1.52e-06	427	496	6	77	Alpha-L-fucosidase C-terminal domain. The C-terminal domain of Structure 1hl8 is constructed of eight anti-parallel-strands packed into two-sheets of five and three strands, respectively, forming a two-layer-sandwich containing a Greek key motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADQ80419.1	1.27e-254	11	508	13	507
BBE17736.1	2.43e-239	31	508	34	512
AMR32276.1	1.60e-233	24	505	26	503
ATP59112.1	6.34e-231	4	507	7	506
QOY86471.1	3.14e-229	22	506	31	525

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LJJ_A	1.88e-97	32	507	43	511	ChainA, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LK7_A Chain A, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135]
7LNP_A	1.04e-96	32	507	43	511	ChainA, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LNP_C Chain C, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LNP_D Chain D, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LNP_E Chain E, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135]
4NI3_A	2.37e-67	29	506	4	491	ChainA, Alpha-fucosidase GH29 [Fusarium graminearum],4NI3_B Chain B, Alpha-fucosidase GH29 [Fusarium graminearum],4PSP_A Chain A, Alpha-fucosidase GH29 [Fusarium graminearum],4PSP_B Chain B, Alpha-fucosidase GH29 [Fusarium graminearum],4PSR_A Chain A, Alpha-fucosidase GH29 [Fusarium graminearum],4PSR_B Chain B, Alpha-fucosidase GH29 [Fusarium graminearum]
1HL8_A	9.76e-45	31	441	7	385	CrystalStructure Of Thermotoga Maritima Alpha-Fucosidase [Thermotoga maritima MSB8],1HL8_B Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase [Thermotoga maritima MSB8],1HL9_A Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With A Mechanism Based Inhibitor [Thermotoga maritima MSB8],1HL9_B Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With A Mechanism Based Inhibitor [Thermotoga maritima MSB8]
1ODU_A	1.87e-44	31	441	7	385	CrystalStructure Of Thermotoga Maritima Alpha-Fucosidase In Complex With Fucose [Thermotoga maritima MSB8],1ODU_B Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With Fucose [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P17164	2.53e-37	38	496	39	446	Tissue alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca1 PE=1 SV=1
C3YWU0	2.82e-37	31	480	17	416	Alpha-L-fucosidase OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_56888 PE=3 SV=2
Q99LJ1	7.71e-37	31	502	22	442	Tissue alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca1 PE=1 SV=1
Q9BTY2	1.23e-35	31	398	33	373	Plasma alpha-L-fucosidase OS=Homo sapiens OX=9606 GN=FUCA2 PE=1 SV=2
P10901	5.47e-35	27	400	16	368	Alpha-L-fucosidase OS=Dictyostelium discoideum OX=44689 GN=alfA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.005212	0.972763	0.021178	0.000344	0.000259	0.000229

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000923_01341.