CAZyme Information: MGYG000000923_01465

Basic Information

• Species: Phocaeicola sp900552645
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900552645
• CAZyme ID: MGYG000000923_01465
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
770	MGYG000000923_6|CGC1	89171.09	8.3588

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000923	2732014	MAG	China	Asia

• Gene Location: Start: 49933; End: 52245 Strand: -

Full Sequence      

MTNLLRKLFLCGVAGVIAVGTSARESEANQVRGIIQKVNNYWQTNNKPEVRSFWDNAAYH
TGNMEAYFLTGNEAYRAYSEAWAKHNQWKGAKSDDKSKWKSSYGETDEYVLFGDYQICFQ
TYADLYNLSGDNYKIARAREVMEYEMSTPNNNYIWWSDGLYMVMPVMTKLYKITRNELYL
DKLYSYVLYSDSIMYDNEEGLYYRDAKYVYPKHKSVNGKKDFWARGDGWVLAGLAKVIKD
LPTDYKHRQFFVDKFIAMSKAVAAIQQPEGYWTRSMMDPAHAPGPETSGTAFFTYGLLWG
VNNGYLDEATYKPVIDKAWNYLKNKALQKDGRVGFVQPIGEKAIPGQIVNEKSTANFGVG
AFLLASCEYVRYLESRNNEDRAYWCSLAYKMAEPVLKNMSEGNLQKNMLVEVSPNWDGRN
KRVTYMEAFGRLMAGIAPWLSLPDDNSEEGKMRKQLRSWAIKSYVNAVNPESPDYLLWRG
HGQALVDAAYVAESFLRAYDQLWMPLDETTKKRYIEEFTQLRRVDPPYTNWLLFSSIIES
FLAKSGAPCDEYRINSAIRKTEEWYTGDGWYADGPQFSFDYYSSYVFHPMYLETLQAMKD
SKIYTRIHYKKYYERALKRTQKFSIVLERFISPEGTFPVFGRSIPYRMATMQPLALMAWY
QQLPATLTNGQVRGALTAVMHRMFDGKENFNEKGFLTIGFAGRQPNIADWYTNNGSLYMT
SLGFLPLGLPAAHSFWTDAEQPWTNRKAWGGEAFPKDHHWKDEIKTWDLF

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH154	380	742	5.3e-109	0.9971264367816092
GH105	45	371	8.5e-79	0.9819277108433735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10022	DUF2264	1.08e-163	380	743	1	351	Uncharacterized protein conserved in bacteria (DUF2264). Members of this family of hypothetical bacterial proteins have no known function.
pfam07470	Glyco_hydro_88	6.42e-95	34	373	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4289	COG4289	3.71e-72	381	754	10	379	Uncharacterized protein [Function unknown].
COG4225	YesR	2.15e-38	62	371	44	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQY40390.1	0.0	1	770	1	771
ABR38224.1	0.0	1	770	2	772
QUT56470.1	0.0	1	770	1	771
QEW35177.1	0.0	1	770	1	771
QQY44631.1	0.0	1	770	1	771

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NOA_A	1.89e-198	1	375	1	377	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	8.10e-159	34	374	19	359	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4CE7_A	1.10e-50	54	371	53	368	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
1NC5_A	3.56e-15	153	368	138	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
3K11_A	7.73e-15	149	401	194	445	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L7P9J4	7.19e-50	54	371	60	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	6.67e-49	155	374	158	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	1.40e-39	156	368	201	407	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	1.95e-14	153	368	138	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.043596	0.946032	0.009009	0.000562	0.000387	0.000376

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000923_01465.