CAZyme Information: MGYG000000923_01660

Basic Information

• Species: Phocaeicola sp900552645
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900552645
• CAZyme ID: MGYG000000923_01660
• CAZy Family: PL10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364	MGYG000000923_7|CGC2	42401.1	7.9083

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000923	2732014	MAG	China	Asia

• Gene Location: Start: 119346; End: 120440 Strand: -

Full Sequence      

MGNKFFITLLLLVSMTNITVNGQDNKMIYKNWQREARKFTSEFYNTPEAERIANNIMLYQ
QTTGGWPKNIYFPAKLTEEEKREILTHKNDVNESTIDNNATTVEIRYMANMYNATHKNDY
KESAIEGIKYLLKAQYDNGGWPQFYPRPTGYYTQITYNDNAMVNVMLQLRDIYESKTPFE
FIPESLKEKAKAAFNNGIECILNTQVMQNGVLTVWCAQHDKNTLKPCKARAYELPSLSGA
ESDEIVLLLMSLPNPSKRVIKSVECAIEWFKNVKIDGLQKESFTNSDGKKDFKMVKCDSC
PTLWARFYELETNRPFFSDRDGIKKYDISEIGYERRNGYSWYNSSGSEVLSEYAKWKRRI
EENK

Enzyme Prediction     

No EC number prediction in MGYG000000923_01660.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL10	60	348	1.2e-119	0.9930555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam09492	Pec_lyase	3.71e-162	60	350	1	289	Pectic acid lyase. Members of this family are isozymes of pectate lyase (EC:4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase.
TIGR02474	pec_lyase	1.67e-147	60	350	1	290	pectate lyase, PelA/Pel-15E family. Members of this family are isozymes of pectate lyase (EC 4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT72566.1	1.22e-175	5	360	6	361
QQA09409.1	1.74e-175	10	360	9	361
BCA51589.1	1.74e-175	10	360	9	361
AAO77361.1	3.50e-175	10	360	9	361
QMW84711.1	3.50e-175	10	360	9	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1R76_A	1.56e-63	43	359	77	407	ChainA, pectate lyase [Niveispirillum irakense]
1GXM_A	1.97e-57	31	351	23	324	Family10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXM_B Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXN_A Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus]
1GXO_A	3.03e-56	31	351	23	324	MutantD189A of Family 10 polysaccharide lyase from Cellvibrio cellulosa in complex with trigalaturonic acid [Cellvibrio japonicus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000210	0.999229	0.000152	0.000145	0.000138	0.000127

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000923_01660.