CAZyme Information: MGYG000000923_01665

Basic Information

• Species: Phocaeicola sp900552645
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900552645
• CAZyme ID: MGYG000000923_01665
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
429	MGYG000000923_7|CGC2	49383.29	7.6902

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000923	2732014	MAG	China	Asia

• Gene Location: Start: 129542; End: 130831 Strand: -

Full Sequence      

MKITSYCKCMLLGVTLIASTSQLFAQKQCTDKPWSVRMADSEMARCPESWQLDFQKGLKW
DYCHGLELQAFLDLYDAYGDKKYFDYAVAYADTMINNDGSIKTYKLEEYNIDRLNSGKML
FRVYDQTKNEKYKRALDLMRSQLDTHPRNDDGGFWHKKIYENQMWLDGLYMGQPFYAEYA
MRNSRVNDYKDIINQFVAVANHTYDSKNDLYRHACDVSKRQKWADKITGQSQHCWGRAMG
WYAMACVDALDFIPVHEQGRDEIIKILNKLAAQMKRTQDPASGVWYQVIDRSGDKGNYLE
SSCSTMFVYTLLKALRKGYIPQDYMDTAKKGYEGIIKTFVKIDEKGLVDITQGCAVAGLG
GNPYRMGDYDYYINEKIRSNDAKAVSPFIMASLEWERLNGCCCKSSKCCCDGKEFSCASK
DCCGDNKCK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	53	397	7.9e-118	0.9819277108433735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	8.10e-121	34	398	1	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.63e-101	60	398	34	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEW38159.1	1.59e-243	1	398	1	398
ALK82868.1	2.26e-243	1	398	1	398
ABR39473.1	4.56e-243	1	398	1	398
QQY38334.1	4.56e-243	1	398	1	398
QUT59627.1	4.56e-243	1	398	1	398

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	7.35e-113	60	398	23	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	5.79e-74	59	398	38	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.41e-73	59	398	28	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3K11_A	2.20e-17	151	398	186	413	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
3QWT_A	3.84e-16	124	337	122	330	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	3.17e-73	59	398	38	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	8.31e-40	171	394	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	8.31e-40	171	394	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000548	0.998680	0.000260	0.000178	0.000174	0.000159

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000923_01665.