CAZyme Information: MGYG000000923_01776

Basic Information

• Species: Phocaeicola sp900552645
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900552645
• CAZyme ID: MGYG000000923_01776
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379	MGYG000000923_9|CGC2	43461.62	9.3297

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000923	2732014	MAG	China	Asia

• Gene Location: Start: 34848; End: 35987 Strand: -

Full Sequence      

MKYYLIAGEASGDLHASNLMKALKAKEPNAEFRFFGGDLMKEVGGTCVKHYREMAYMGFI
PVLLNLNKIFRNLKDCKDDIVRWNPDVVILIDYPGFNLKIASFLKSATSIPAYYYISPKI
WAWKEHRIKNIKRDIDEMLSILPFEIDFYKKHDYRIDYVGNPCMDAVQNFMSSQNETFEQ
FISKNSLSAKPIIAMLAGSRKQEIKDNLPLMMDAAKEFNDNYQFVVAGAPGIEKDFYDKF
ITKDTKILFGQTYSILQHSTAALVTSGTATLETAIFRVPQIVCYYTPIGKLYSFLKKHFL
KVKYISLVNLIANKEVVKELVAHEMKVDNIKKELKAILYDRNYHDRMVGEYDNIINILGT
GSASKKAAEVIIKKLSNQY

Enzyme Prediction     

No EC number prediction in MGYG000000923_01776.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	356	2.8e-113	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	7.96e-95	1	373	2	373	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.32e-93	1	376	2	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	6.75e-71	4	338	2	339	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.39e-57	5	372	10	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	8.32e-51	1	375	2	347	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQY38221.1	6.55e-183	1	375	1	377
ABR39591.1	6.55e-183	1	375	1	377
QRO23865.1	8.96e-183	1	378	1	377
QUT59470.1	1.32e-182	1	375	1	377
QQY41518.1	1.32e-182	1	375	1	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	1.77e-32	5	338	11	345	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	4.68e-32	5	338	11	345	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	2.49e-59	5	375	9	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2LVL8	3.51e-59	5	374	8	380	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
B6J161	5.78e-59	5	371	8	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1
A9KC41	8.13e-59	5	371	8	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain Dugway 5J108-111) OX=434922 GN=lpxB PE=3 SV=1
Q83DS5	1.14e-58	5	371	8	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) OX=227377 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000923_01776.