CAZyme Information: MGYG000000924_00311

Basic Information

• Species: An172 sp002160515
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; An172; An172 sp002160515
• CAZyme ID: MGYG000000924_00311
• CAZy Family: GH101
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1889		209819.55	4.1879

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000924	2081481	MAG	China	Asia

• Gene Location: Start: 7252; End: 12921 Strand: +

Full Sequence      

MKRIVNRGLAVLLTVMMLTGLIPMNMSISAEENGGWRIQDWGGSEDVTVEEGWITPAEEG
NGFTLDYSKVISDRGKEGLVIYDSNAKKMINSTLELDVTLTKGTSEDAETQSNFYSFGIF
PIFKDGANCEGINIHDKGHLEHSRQNNGSESYNWIRGDEGDFIFGETYHLKLVTMDGNVT
LYAAKKGEELQEKSSFKCDSNLGATGYGFRVWRGAKTIKVENIVRTEISSSYLVNKEAEI
LDSEWMSATIEIPVVLKEGDSIASISDGTMDLTPGSHYSVLDNVITISPDYMKTQGTNNE
ITLTVNFALGDKDTFKIIRKIEGDGGWKMYRQSSTDVTETKPGWITVSDGGSKVVIDYGR
AVDESGAEGFVVLNKEAPEYQNSMLEYDITFSDATQAPWIAVAPVTRGVDGGNYEGFAIT
QGTGLERTGRINGSESYAGIDNKLGVSFEYDKTYHIRMETIDNHITVYLTRDGKEEKLTE
FDSPIGIEKGTYGFRIWRGGKTITIENIKRTEIITSKFEKSVIQVDKDVWGENDVTANVS
FGTGDSIKTIKSGDTTLENGKDYTVEGNVFTLKKEYVAAQSGNFRLQVEFAMGSVTSLWI
MKYDPDHAQEYTWTPDQGIDMWKSIDGNGSFELTEDGTAMRVTGTTALMNELAPLVANGE
IEITFEALRDLDGFDAGAMFRADDVTGDWQSLASTDSINGEGVWDFINNGSKNRYIWDGQ
QNMSLDGVQDMKIKVRYVDDSITLWRDDQFAHTAQVSQAETNVGGMGLYVDNNGDILVKK
VVFREVTPYQEAEGEREPVTIENDGLSVRLDSDFPHVIDYTLNGKVMNGSELRYNYVTIN
TVDYKATAEITEQTENSITYHVTPDGIDVPFDVVFTVKEEQIVEMLIKNIDESSVTVNSI
GFPAQPLISANSAQADASLDAAWVEENNRQIRDLTEKISDKNVSTVAPRSVNTPFISADG
LSASMFNNCYLGGEEFVYLGFDLDNGEKSVGVWNQDFMYRGIDGEKILPFASEPDENDLY
CRIVITEDNNGDGIANWQDGANALQTLVSDLIPGGDDAARSFFHVGYNFASGAQQPFLKV
ADNMKRLSNYIDGFSQQVIFKGYASEGHDSGHSEFSDINSRAGGAEDFATAIAEADKINS
NIGIHINVQETYPEAETFDDHTTGDRNGWRWMDQSKIIRRYVYMLEGGFDDQLNSLFDQV
PDLDFVYMDCWGEDRWGEKKLIGNLLENGAEMFADENAPDLMRFGAWVHSAANNSQIHQF
TYNSQKDIYPGSSIYWGGYGRSASMMSWQHKNNINTLVEQFYTNQLPQKYLMCHEVQRVA
DGVGYFSDNVTSGNYTITKDGKKLTDGNGKIFIPWYDEDTSVDRNPDEAAKIYHWNSNGG
KTTWDLPDSWSDVTTVYLYRTTQDGKTDEKAIKVENGQVTLDVEAKTPYVLYKEPQEADV
TEWSVGSELKDTGFNSRDFSIWQNSGDADIYYEDDGNGVSILNIKGSEDGQVSQTMEGLV
PGQKYRVVVHAGVENGKTARLTVDTGTNTYENYLEKVGMTNQYFDSYVKGKNMQRMWVDF
VAESDTATVTLSGDACDSADGKTTFMETRIVKTAEPDLPEGYVANETFEYVEQGAYGIFN
PERSADGVPHLSETHRPYTNDTINGDWSLKLYGHYGQGNVTVRTSPATMRLEPNTTYTVE
FDTLGDGKVYIQSEADGNDKVLEESYSAGHHKYTFTTGDKNDYIARIERSSVLDNFKVYL
TDEVTEVTGIDIENKEIEMSVGDTLTLNPTIQPVEANNKQVVWNTDENDIVSVDQTGKLV
AVAKGTTTITGTTLEGGYTVTVTVTVTDKEYAKGDVNHDGTLNIDDATLIQQFLVELNPD
NFDQTLADMNDDGVINIIDATLIQLAIKA

Enzyme Prediction     

No EC number prediction in MGYG000000924_00311.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH101	806	1322	1.3e-85	0.7906647807637907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam12905	Glyco_hydro_101	4.66e-55	1038	1296	1	271	Endo-alpha-N-acetylgalactosaminidase. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae is largely determined by the ability to degrade host glycoproteins and to metabolize the resultant carbohydrates. This family is the enzymatic region, EC:3.2.1.97, of the cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins. This reaction is exemplified by the S. pneumoniae protein Endo-alpha-N-acetylgalactosaminidase, where Asp764 is the catalytic nucleophile-base and Glu796 the catalytic proton donor.
cd14244	GH_101_like	9.33e-54	1053	1318	2	295	Endo-a-N-acetylgalactosaminidase and related glcyosyl hydrolases. This family contains the enzymatically active domain of cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins (EC:3.2.1.97). It has been classified as glycosyl hydrolase family 101 in the Cazy resource. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae and other commensal human bacteria is largely determined by their ability to degrade host glycoproteins and to metabolize the resultant carbohydrates.
pfam18080	Gal_mutarotas_3	4.26e-39	801	1037	1	243	Galactose mutarotase-like fold domain. This domain is found in endo-alpha-N-acetylgalactosaminidase present in Streptococcus pneumoniae. Endo-alpha-N-acetylgalactosaminidase is a cell surface-anchored glycoside hydrolase involved in the breakdown of mucin type O-linked glycans. The domain, known as domain 2, exhibits strong structural similarlity to the galactose mutarotase-like fold but lacks the active site residues. Domains, found in a number of glycoside hydrolases, structurally similar to domain 2 confer stability to the multidomain architectures.
pfam17451	Glyco_hyd_101C	1.16e-18	1306	1407	3	111	Glycosyl hydrolase 101 beta sandwich domain. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae is largely determined by the ability to degrade host glycoproteins and to metabolize the resultant carbohydrates. This family is the enzymatic region, EC:3.2.1.97, of the cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins. This reaction is exemplified by a S. pneumoniae protein, where Asp764 is the catalytic nucleophile-base and Glu796 the catalytic proton donor. This domain represents C-terminal the beta sandwich domain.
cd14256	Dockerin_I	3.50e-12	1833	1888	1	57	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATD58436.1	5.23e-182	343	1748	239	1630
ATD54117.1	5.23e-182	343	1748	239	1630
QBJ76357.1	5.23e-182	343	1748	239	1630
SLK22612.1	5.23e-182	343	1748	239	1630
BBK22105.1	4.64e-159	343	1748	69	1478

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6QEP_A	2.45e-101	800	1714	11	1053	EngBFDARPin Fusion 4b H14 [Bifidobacterium longum]
6SH9_B	2.54e-101	800	1714	11	1053	EngBFDARPin Fusion 4b D12 [Bifidobacterium longum subsp. longum JCM 1217]
6QFK_A	2.54e-101	800	1714	11	1053	EngBFDARPin Fusion 4b G10 [Bifidobacterium longum]
6QEV_B	2.54e-101	800	1714	11	1053	EngBFDARPin Fusion 4b B6 [Bifidobacterium longum]
2ZXQ_A	3.13e-101	800	1714	26	1068	Crystalstructure of endo-alpha-N-acetylgalactosaminidase from Bifidobacterium longum (EngBF) [Bifidobacterium longum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2MGH6	3.47e-90	800	1682	333	1319	Endo-alpha-N-acetylgalactosaminidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_0368 PE=1 SV=1
Q8DR60	2.42e-89	800	1682	333	1319	Endo-alpha-N-acetylgalactosaminidase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=spr0328 PE=1 SV=1
A9WNA0	3.15e-79	799	1705	50	988	Putative endo-alpha-N-acetylgalactosaminidase OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) OX=288705 GN=RSal33209_1326 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000493	0.998631	0.000288	0.000206	0.000166	0.000152

TMHMM  Annotations     

start	end
7	29