CAZyme Information: MGYG000000927_01480

Basic Information

• Species: Phascolarctobacterium_A sp900545025
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Phascolarctobacterium_A; Phascolarctobacterium_A sp900545025
• CAZyme ID: MGYG000000927_01480
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
532		60395.17	9.301

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000927	1752526	MAG	China	Asia

• Gene Location: Start: 25712; End: 27310 Strand: +

Full Sequence      

MSKTYKYLFWLSAVLLLFFSNNNLLITDSVESNYALTAKEMVLSGDWISPQIYGHYWFDK
PVMFYWLTAIAFKIFGFTEFAARFFPAVFGLAALGLVYWGGSKLYNERTGFFSSIVLLSC
IEFFLISKSVITDAVLFLFFSGTLLFFYLAYTSGNRRDWYFMYICAALATLTKGPVGFLL
PGLIITLFMIWQKQWRLPLRMHLVTGTILFALITVPWYGMMVYLHGADFLNTFLGTHNFL
RATVSEHPRDNVIYYYTAVNLLAFFPWSMLVPVIVVRLVRRKSFALPEKEQFLLLWAGTI
FIFFQCMATKYITYTYPMLFPGALLLGSYLQRHEEVLHSRWFLGLITGGFALLSLSAYWS
VGKGIAAGNMLYFIPAALTVGLLLYPLLRQQSGGAFYSIGCTCVVFYLALTACIAVPFSA
QRSARDLGLLLPQLTAADSVGVYGSYPTSAVFYSGKRIVKLLPANEVKNFLPQAYSWSSK
NVMPYAEVEQEQFPLVIVGKRRMDDFAMISQATWNPKVILQDWVIVQPAEQG

Enzyme Prediction     

No EC number prediction in MGYG000000927_01480.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	6	459	8.6e-105	0.8703703703703703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	3.22e-49	13	359	17	367	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	7.32e-33	1	357	2	362	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	1.26e-20	59	217	1	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	2.57e-12	31	218	32	231	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG1287	Stt3	0.007	59	191	86	211	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTV78033.1	9.01e-209	1	527	1	525
AEQ23377.1	1.30e-145	1	498	1	510
ADB46704.1	7.80e-142	1	526	1	542
AXL22207.1	1.40e-121	12	529	39	512
AVO27725.1	7.50e-116	13	529	35	509

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	6.18e-28	31	332	59	366	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	5.62e-25	6	508	4	495	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
A4SQX1	1.85e-24	31	328	30	328	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas salmonicida (strain A449) OX=382245 GN=arnT PE=3 SV=1
C6DAW3	4.66e-24	31	451	35	434	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) OX=561230 GN=arnT PE=3 SV=1
B4ETL9	8.22e-24	2	329	7	335	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT2 PE=3 SV=1
B4EUL1	1.44e-23	1	335	5	338	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.979365	0.020302	0.000206	0.000035	0.000032	0.000092

TMHMM  Annotations     

start	end
7	26
62	77
84	101
111	130
135	154
169	191
203	225
257	279
292	314
337	359
364	386
396	418