CAZyme Information: MGYG000000929_00355

Basic Information

• Species: CAG-273 sp000437855
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-273; CAG-273 sp000437855
• CAZyme ID: MGYG000000929_00355
• CAZy Family: GT51
• CAZyme Description: Monofunctional glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
239		27384.21	4.7663

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000929	1183274	MAG	Germany	Europe

• Gene Location: Start: 12362; End: 13081 Strand: +

Full Sequence      

MVKFIKRTLLFILIIVIIASGFVLYQGHKVYKNALDSVSLEDKIQKIKNDDSYVELSSLP
TYYKDAIVSVEDHRYYDHGPVDLIAILRATVSNIRNKDFVEGGSTITQQVAKNLYFISTD
TNSLYRKIAEIFMAYDLEENYNKDDILEFYVNTIYFGDGYYGVDEACNGYFKKSAKDMSL
YEATMLAGIPNAPSVYAPTVNKDLALNRQRKVISTMVENEYLTQEQADELIKMQEKETL

Enzyme Prediction     

No EC number prediction in MGYG000000929_00355.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	44	217	1.1e-59	0.9717514124293786

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	1.46e-72	53	232	4	181	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam00912	Transgly	5.34e-72	53	217	15	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG0744	MrcB	3.09e-68	53	232	78	256	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	4.83e-61	53	232	69	246	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK13481	PRK13481	3.82e-43	42	231	36	229	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRP41835.1	2.02e-73	5	227	7	227
ASN93505.1	2.02e-73	5	227	7	227
SET89048.1	8.43e-73	7	228	8	228
QIX92252.1	1.16e-72	5	227	7	227
ANU46909.1	1.64e-72	5	227	7	227

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	2.99e-41	53	231	22	198	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	1.19e-40	53	231	22	198	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
3HZS_A	5.35e-38	25	196	4	170	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]
6FTB_A	5.50e-38	25	196	5	171	Staphylococcusaureus monofunctional glycosyltransferase in complex with moenomycin [Staphylococcus aureus MW2]
5ZZK_A	2.01e-37	24	196	33	206	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O87626	3.66e-39	53	232	70	247	Penicillin-binding protein 1A OS=Neisseria flavescens OX=484 GN=mrcA PE=3 SV=1
P0A0Z5	4.42e-38	53	231	70	246	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=mrcA PE=3 SV=1
O87579	4.42e-38	32	231	47	246	Penicillin-binding protein 1A OS=Neisseria lactamica OX=486 GN=mrcA PE=3 SV=1
O05131	4.42e-38	53	231	70	246	Penicillin-binding protein 1A OS=Neisseria gonorrhoeae OX=485 GN=mrcA PE=1 SV=3
P0A0Z6	4.42e-38	53	231	70	246	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=mrcA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.988018	0.007445	0.003919	0.000046	0.000025	0.000579

TMHMM  Annotations     

start	end
9	28