CAZyme Information: MGYG000000930_00041

Basic Information

• Species: Absicoccus porci
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Absicoccus; Absicoccus porci
• CAZyme ID: MGYG000000930_00041
• CAZy Family: GT2
• CAZyme Description: Teichoic acid poly(glycerol phosphate) polymerase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399	MGYG000000930_1|CGC1	48011.69	7.3524

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000930	1894829	MAG	Germany	Europe

• Gene Location: Start: 40621; End: 41820 Strand: -

Full Sequence      

MAWKQNMIRHAKRLVIRCFKVVYKGMQKTVSVDEHTVIFIAFHGRGYTDNPKYIHQEMCK
QSRFDDYTFVWALKKPNVEIEHAKTIRYNSLHYFYYMCKAKYWIVNCKLPKHIQKKPEQV
YLQTWHGTPLKRLAHDIVEVENQTFYRSGMNRKQMTDTYDDDVAKYNYMIAPNEFSYEVF
QTAFRINPKRLIKTGYPRNDFLTNITPEEIENIKQRFHIPAHKKILLYAPTWRDNSYNTR
GYTFELKADFHRWKEVLGDEYVVLFKPHYLIINKFENDASLEGFIYNVDANADINDLYVI
SDVLVTDYSSVFFDYANLNRPMYFYMFDLEEYADELRGFYFDIYEVMPGDIIQDEEQLLA
DIKKGQYDFKRLEAFNQRFNNWQDGHASQRVIDIVFGKE

Enzyme Prediction     

No EC number prediction in MGYG000000930_00041.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04464	Glyphos_transf	1.45e-118	32	397	2	360	CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
COG1887	TagB	7.60e-93	11	399	3	388	CDP-glycerol glycerophosphotransferase, TagB/SpsB family [Cell wall/membrane/envelope biogenesis, Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKG72826.1	3.46e-107	20	398	334	709
QQD84451.1	3.80e-106	22	398	336	709
ALM58135.1	6.01e-100	5	399	320	718
QHD16240.1	8.45e-100	5	399	320	718
ANK38846.1	4.65e-99	5	399	320	718

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3L7I_A	1.30e-88	8	395	323	714	Structureof the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_B Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_C Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_D Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A]
3L7J_A	1.38e-87	8	395	323	714	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]
3L7M_A	3.81e-87	8	395	323	714	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P13485	7.81e-92	13	399	361	746	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagF PE=1 SV=1
Q5HLM5	6.02e-88	8	395	323	714	Teichoic acid poly(glycerol phosphate) polymerase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=tagF PE=1 SV=1
Q2G1C1	9.92e-87	12	396	7	388	Teichoic acid glycerol-phosphate transferase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=tarF PE=1 SV=1
Q8RKI5	2.58e-85	4	397	2	394	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarF PE=1 SV=1
Q8RKJ2	7.87e-41	28	399	251	608	Teichoic acid poly(ribitol-phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarL PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000930_00041.