CAZyme Information: MGYG000000931_01222

Basic Information

• Species: UMGS75 sp900538885
• Lineage: Bacteria; Firmicutes; Bacilli; ML615J-28; CAG-313; UMGS75; UMGS75 sp900538885
• CAZyme ID: MGYG000000931_01222
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
896	MGYG000000931_54|CGC1	102453.22	4.5858

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000931	1690546	MAG	Germany	Europe

• Gene Location: Start: 3928; End: 6618 Strand: +

Full Sequence      

MRKYLVICFMILFLLVGCVDENKKEYKLILNLNNGSGEQIIEELDEPTSVDLVTPTRDGY
DFVGWKCDGNILTESTIYVDKVITLNAVWNGKEYQVTLIDELDGYKNEMKVKYGDMLSLT
DRKYPGYKFLGWYKETELVEGGVYDYLEDITLYARYEKNTYSISYYVDGEIYETVDVLYD
DYVKHLDVEKKGYRFIGWYLDNVRVSNGKYQYTSDITLTAKFEQETYIINFIDGNKEVQQ
PIYVKYLENIALPVMSKTGYTFLGWYDGEQKIEDGPYLGTYSMSLYTKWTPNTYYITFMS
DGEEVLEPLEVKYNTSFELPSFNKDGSTFLGWYYNENILEDGKYLYLHDITVVANWKDGI
TKSYIGKIDVTLFNTQTARYDEVSIFDSSTNITASRYWHKYAIVKEKDYYKISGIAGSGE
PLSTLGSYDYVILAYTDYAKYSEFVNIGLNIGDIVEFSVDPTHFVKGSINVTVSCYNTLY
PDPDKNEFINYLNSLYGNITSLDNDINLVKSYLGHQIIWKTSNKNVITSSGKYTKPAVTR
NVTLTAIVNKKEIYNFTVKVKGDKEQSEALATGYFYTRFSDSTEDTFKNLDIAYISFAYV
NSNGEFTNMSETSTFLKNLLSNIVPKARKAGTKIVISINQENHEFGTIAGDATLRKTFAN
NIVKMLNKYEFDGIDIDWETPTTAEAPTFTLLMKEIYETVKANNPSHLVTAAIGGGRWQP
PKYDLQNSSQYLDYINLMTYSMVSRNGQFHNALYKSSKGYTLSSCSIEESIEIYDSYNVP
RDKILIGLAFYGIKQTGSKGVGTACVSSSSYTYRGIYHDYLENPREGVEICFDEETASPY
IYDAINGVFISYENELSIAKKCDYVNSLGLAGVMYWQDGHDYNDVLLDAIKTNIKK

Enzyme Prediction     

No EC number prediction in MGYG000000931_01222.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	584	884	4.4e-55	0.8648648648648649

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00636	Glyco_18	2.29e-50	573	881	4	334	Glyco_18 domain.
cd06548	GH18_chitinase	7.91e-50	626	876	79	317	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
pfam00704	Glyco_hydro_18	9.12e-44	572	876	2	302	Glycosyl hydrolases family 18.
cd02872	GH18_chitolectin_chitotriosidase	9.70e-41	596	876	34	336	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
COG3325	ChiA	2.00e-34	626	890	121	432	Chitinase, GH18 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUD63190.1	7.70e-92	443	896	278	735
AUD65244.1	3.35e-90	449	896	293	742
BCR35892.1	1.14e-86	490	896	318	724
VEU83132.1	1.09e-80	490	896	313	726
CCV65692.1	1.02e-78	476	896	300	728

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6INX_A	9.99e-31	570	895	6	343	Structuralinsights into a novel glycoside hydrolase family 18 N-acetylglucosaminidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
5GZU_A	9.41e-28	626	881	104	377	CrystalStructure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZU_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_A Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
5GZT_B	1.23e-27	626	881	355	628	CrystalStructure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
1D2K_A	1.01e-26	626	881	81	348	ChainA, CHITINASE 1 [Coccidioides immitis],1LL4_A Chain A, Chitinase 1 [Coccidioides immitis],1LL4_B Chain B, Chitinase 1 [Coccidioides immitis],1LL4_C Chain C, Chitinase 1 [Coccidioides immitis],1LL4_D Chain D, Chitinase 1 [Coccidioides immitis]
6BT9_A	1.56e-26	626	877	152	444	ChitinaseChiA74 from Bacillus thuringiensis [Bacillus thuringiensis],6BT9_B Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1E3R8	9.13e-26	626	881	116	383	Endochitinase 1 OS=Coccidioides immitis (strain RS) OX=246410 GN=CTS1 PE=3 SV=1
P0CB51	9.13e-26	626	881	116	383	Endochitinase 1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) OX=443226 GN=CTS1 PE=1 SV=1
C5P230	9.13e-26	626	881	116	383	Endochitinase 1 OS=Coccidioides posadasii (strain C735) OX=222929 GN=CTS1 PE=3 SV=1
E9QRF2	4.30e-25	626	881	122	389	Endochitinase B1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chiB1 PE=3 SV=1
Q873X9	4.30e-25	626	881	122	389	Endochitinase B1 OS=Neosartorya fumigata OX=746128 GN=chiB1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000068	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000931_01222.