CAZyme Information: MGYG000000932_00373

Basic Information

• Species: UMGS577 sp900543525
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS577; UMGS577 sp900543525
• CAZyme ID: MGYG000000932_00373
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1367		149138.54	4.3222

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000932	1983140	MAG	Germany	Europe

• Gene Location: Start: 8222; End: 12325 Strand: +

Full Sequence      

MRSPRERRFPPLFRGGFKLQYSPDKKTWLDIPGQSYTDYTPAEGETVFTFSPVEAQKIRI
VATQYGKDDAGYYLIQLGGVRVYGVIIAPPAAAIWGESPITEPYDYVSDGSFSGKAQPAS
PDPLVAYRWENPTADDALEIFLRRPVSVWSDTPEQFSGLDSLTTENAAVEVKGVGCIRMD
FGAEFAGWLEIDAPDLSGEITLGVSEYNQPAIVNRGPQSPAKTATPVKYGDTYWLELNSE
LYEGARFGFITVVGFDRPFTITGVRLVCQTKPINYEGSFDSDNETLNKIWYAAAYDVRAN
LKEDYLAAILVDRGDRHSWTGDAYTSQAASLAAFGNYDFILKNLRYTAVRPNGIESYELY
WVPSLIDYYEYSGDAAGVESLLSEATARLDHAYEIYGSNPSLGFFGWDERLGAGFENPNL
EENQNSYKLLSIQAWKDFAAVLTGIGQTGLAQKYAGYADEKTAELTADPEFYKAYGLHAS
ADAINAGVGDVDTLYHADFGDRLNRISYSPFNEYMLLQAMARAGKYDDAISAVLDLWGGQ
IKYGGTMFFETFRPGWNEIIGQNDPVPNNQAGYTSLAHPWSAGVLSWLNEEILGIKAETA
GFSSFTVKPHLGRQLEWVSGGTPTPYGTIEASFDTAAGLHTVTVPEGTVATVAIPKVERR
IAAITLNGGAASPTEEDADYLYFTGLASGSYTFRTQYDGTTPEYVEGEYLYPAEFVGMDT
ETRGSWNGVYGADGYLLPGYNGDDVRVLPEYVRSVRLSKGRRVTLAATSDDARAMPSNPF
GAGGRALGAYQSDDDTACYQTFAVDIDLLREQEYTVALYFADWECAGRELMVEMFDGRTL
NLIAPLQALHDYSGGVYLVYRCDRSTRFRINHIRGKNASLSGIFFGEGAGSASVRSTELV
DDPDARITYTGAWNHNPLGDAYNGTFIYTDAAGASAELRFTGSGVAYVASLENNRGIAEV
YLDGEYRGRFDLYSAGTVRQDPVFADNDLEYGEHTIRVVVTGEKNPLATGAYVDIDAFEI
HMPFTNVRESKTDDRDAVVSYTGAWTHDPIGGAWQDTFGYSGQTGDTAAFTFTGVGISYI
ASREANRGIAQIRVDGEVKGTVDLYSAETLRQQEVFRLDGLPDGQHTIEVAVTGEKNPQS
SGVYVDVDAFAVRSPLYNVSSLADGMTIQNPKRGAASLTPPPMPEGFTVSIVESSRPEVL
GPDGSIHALREDTTLQLTLQVSDGQSTARRIVSITVPGTASSEAEIQQVIERIAALPDRC
ALALSDMEAVSAARSAHEALDAAGRERVTNLSKLVQLERDLQILSSGRRGDVDMDDSRTV
SDVVLLRGVIVSGERLPSAQFWSADLDGDGKLTVSDVIALRQMIVQA

Enzyme Prediction     

No EC number prediction in MGYG000000932_00373.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	176	653	7.7e-69	0.9821428571428571

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14256	Dockerin_I	2.03e-11	1309	1365	1	57	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.
pfam17390	Bac_rhamnosid_C	6.88e-07	594	669	1	78	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17389	Bac_rhamnosid6H	7.64e-06	277	588	4	336	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17996	CE2_N	0.002	922	999	1	81	Carbohydrate esterase 2 N-terminal. This is the N-terminal beta-sheet domain with jelly roll topology found in CE2 acetyl-esterase from the bacterium Clostridium thermocellum. This enzyme displays dual activities, it catalyses the deacetylation of plant polysaccharides and also potentiates the activity of its appended cellulase catalytic module through its noncatalytic cellulose binding function. This N-terminal jelly-roll domain appears to extend the substrate/cellulose binding cleft of the catalytic domain in C.thermocellum.
pfam00754	F5_F8_type_C	0.004	17	75	66	124	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA24541.1	1.84e-261	97	885	28	819
QEC76313.1	1.06e-256	113	885	53	843
ATP56756.1	8.79e-238	118	887	44	819
QMW04815.1	1.02e-236	93	885	26	815
ACT93515.1	1.85e-228	93	885	43	830

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	4.12e-26	153	634	171	677	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0DTR5	3.51e-22	898	1130	834	1060	A type blood alpha-D-galactosamine galactosaminidase OS=Flavonifractor plautii OX=292800 PE=1 SV=1
P0DTR4	7.72e-15	900	999	658	756	A type blood N-acetyl-alpha-D-galactosamine deacetylase OS=Flavonifractor plautii OX=292800 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000932_00373.