CAZyme Information: MGYG000000932_00828

Basic Information

• Species: UMGS577 sp900543525
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS577; UMGS577 sp900543525
• CAZyme ID: MGYG000000932_00828
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1560		169869.58	4.2813

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000932	1983140	MAG	Germany	Europe

• Gene Location: Start: 17658; End: 22340 Strand: -

Full Sequence      

MNSFWKRIACFCLAVTLLMPALLSAPAVAADPEEEFKVYNLKVCETAQPLGVDAVPTFSW
ELDTAARDAAQSAYRIIVASSEEKAAAFTGDVWDSGKTEGENNYDITYAGPALSERTGYY
WCVEAWDNAGHSARSAVGFFLTGIWEEDSWKGDWIGTERKSYDLDMTGANWIWKRDTSGF
GGSPAGTQYMRKTFTPNPDKTIREVLVGYTADDQTVFYFNGTEQGSTSSWSTGGLFDATA
SVKAGANVVAIAGTNTSDGYAGLLSKIMVRYADGTEDVYVSDASWKVSDKLVDGWYAEAF
DDSAWSAPTQSVSFGSDPWGTGVSLEKAGSRAAVTLRKEFAVDKKIASAYAYVCGLGFFD
FTVNGKQADDTLLNPCNTQYDQTALYRVFDVTDLLSAGRNAVGVELGNSFYNEIGGVWNW
PSATWRDEPKLLFNLDIHYTDGTVDTVASDTSWKLTKNGPTISNGVYYGDSYDARKELTG
FNTAGYDDSAWTAASVVEGTGGRLSCQLSDPVRRTSTFTVKSITRVGTDSYVVATPEMTT
GWIKLMSINASAGDRIAITYGEKLNSDGTVQKLGGSDGVCSNWWPHAYNQQDIYISAGKE
NESFEPKFSYKGFQYVQIDGYPGELTADDLEIYRVSNDVAIASEIETSNTMVNQLHKLMR
TTLLNNFQGKPTDTPVWEKNGWLGDANAGLLTMLYNFDMSNYLPNFIEIMEDCFNLYGTV
PDMVPTAGWWLNGNAAVWNTIYVIGTAELWNTYGMENYTEVQYDSMRQFALKDMEEIEKN
GWVWVDGQLSDWCSPVGGSNPDVGYNEGDSEGSRICGTAFVYKMLSCMKDIAENLGKTAD
AKEYADAMANIYTAFNQSFYNKSKGIYETGRFNQVGSRTEYRQTSNLAALAFGFVPEEYV
ETVVANLVKDIEEKNYHLDTGVVGTRLILPVLCDYGYSQVAYRILTQDTYPSWGYWLSQG
ATSAWEMWEKTSRSLDHYFLGTYDEWLYSHLAGITDAKDGYKTFTIHPYLVGDIDYVNAS
LQTVRGKVESNWSLNADGTATMKLTVPVGSTATVYFPTARTSNIRLDGERLTTSLDGVKE
VSFDGTQIYAVIGSGEYSFTTGTDLTSLYTDSLAEAIKTAEAADMTAIPEALVKDLNAAI
AAGKATLAKSNAVQHEINAAAAAIEAALAATKGSEARIALRKAVAAADAAAPAAGIYSAE
AYAAYTSALLTARKLAENYDVPDAQLVTAKAYLQDAIDALGDAKLNNRALGAKVTASSTH
EDTYWNWGAALMTDGDTKNVNRENDYTGYCSNLTTDRNHAEWVAVDLGEVQLINNVTIYA
ACANVSGEMIGYGMPIDFTIQVSEDNQNWKTVHTETNYPLPGYGPQSFSFEDASARYVKL
DATSLRPKGTEGNSYRMQFSELEVYRLDGTAGNIEALTYLELDGVVLNEVFKLGQTAYTA
NVSAEVSQVTLTPYTTEGAAVKVNGEAVSGSAVLPLSDGENVITVTVGGVDTHLTVVKEA
GGRRRGDIDGDGKVTVSDVVELRKQIVNGTADRAICDLDGDSKVTVSDVVELRKIIVQGA

Enzyme Prediction     

No EC number prediction in MGYG000000932_00828.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	523	1055	1e-133	0.996031746031746
CBM67	331	501	1.3e-34	0.8977272727272727
CBM67	169	319	1.4e-28	0.9943181818181818
CBM32	1255	1401	9.6e-20	0.9516129032258065

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.13e-87	642	991	3	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	4.80e-56	344	515	1	171	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	3.26e-17	524	636	1	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.25e-14	993	1062	1	69	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam00754	F5_F8_type_C	6.27e-12	1253	1384	1	114	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI59736.1	0.0	3	1407	2	1408
AQS56111.1	1.09e-232	78	1100	1	1015
QYJ14959.1	4.79e-229	6	1099	2	1079
SDU74751.1	1.17e-212	48	1057	58	1050
AEK42215.1	2.80e-212	14	1099	10	1058

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	2.61e-134	48	1100	16	1029	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6I60_A	2.37e-127	36	1099	30	939	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
6GSZ_A	2.04e-71	266	1057	42	847	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6T0Q_A	5.32e-16	164	328	193	353	PleurotusOstreatus Lectin (POL), apo form [Pleurotus ostreatus]
6T1D_A	5.50e-16	164	328	196	356	PleurotusOstreatus Lectin (POL), compelx with melibiose [Pleurotus ostreatus],6T1D_B Pleurotus Ostreatus Lectin (POL), compelx with melibiose [Pleurotus ostreatus],6T1D_C Pleurotus Ostreatus Lectin (POL), compelx with melibiose [Pleurotus ostreatus],6T1D_D Pleurotus Ostreatus Lectin (POL), compelx with melibiose [Pleurotus ostreatus],6T1D_E Pleurotus Ostreatus Lectin (POL), compelx with melibiose [Pleurotus ostreatus],6T1D_F Pleurotus Ostreatus Lectin (POL), compelx with melibiose [Pleurotus ostreatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	1.06e-133	48	1100	16	1029	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KPL4	2.51e-93	47	1097	41	945	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
T2KNB2	1.20e-85	336	1099	177	920	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	2.67e-73	336	1052	173	874	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KM26	1.03e-11	613	1047	700	1127	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000350	0.998951	0.000204	0.000171	0.000152	0.000148

TMHMM  Annotations     

start	end
7	29