CAZyme Information: MGYG000000932_00932

Basic Information

• Species: UMGS577 sp900543525
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS577; UMGS577 sp900543525
• CAZyme ID: MGYG000000932_00932
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
188		20786.62	4.5912

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000932	1983140	MAG	Germany	Europe

• Gene Location: Start: 11718; End: 12284 Strand: +

Full Sequence      

MKLAVRIVATLAVVSLCILLLGFAFSKVTEAFYPRKYSEIVEKYSAEYGVDADLVFAVIK
CESGFDPEAVSHADAKGLMQMTEETFDWVQTKTGEQGLAADALFDPEISIKYGVKLLSLN
LQEFGNEAAAIAAYHAGRTAVAGWLKNADYSSDGDTLDAIPYAETRAYVERVQKTRKIYE
NIYRKDAE

Enzyme Prediction     

No EC number prediction in MGYG000000932_00932.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	52	176	4.2e-27	0.7777777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	2.39e-59	34	178	1	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.90e-35	33	185	2	151	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
COG0741	MltE	1.95e-23	27	183	129	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd00254	LT-like	3.75e-23	52	172	1	106	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16893	LT_MltC_MltE	4.03e-23	39	119	1	84	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCN93454.1	8.36e-49	33	183	38	189
AYF42704.1	8.36e-49	33	183	38	189
AYF39872.1	8.36e-49	33	183	38	189
AVQ97208.1	8.36e-49	33	183	38	189
ADU28212.1	8.36e-49	33	183	38	189

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FBT_A	2.24e-14	33	179	445	592	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	2.26e-14	33	179	474	621	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FCQ_A	5.60e-14	33	179	445	592	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FC4_A	5.61e-14	33	179	446	593	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
4C5F_A	4.05e-12	35	179	172	338	Structureof Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli],4C5F_B Structure of Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C5BCE9	2.49e-14	35	182	189	358	Membrane-bound lytic murein transglycosylase C OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=mltC PE=3 SV=1
A9MQR3	4.18e-13	35	179	191	357	Membrane-bound lytic murein transglycosylase C OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) OX=41514 GN=mltC PE=3 SV=2
A7MLX9	7.78e-13	35	179	191	357	Membrane-bound lytic murein transglycosylase C OS=Cronobacter sakazakii (strain ATCC BAA-894) OX=290339 GN=mltC PE=3 SV=2
Q5PMM0	1.45e-12	35	179	191	357	Membrane-bound lytic murein transglycosylase C OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) OX=295319 GN=mltC PE=3 SV=2
Q8Z3T9	1.45e-12	35	179	191	357	Membrane-bound lytic murein transglycosylase C OS=Salmonella typhi OX=90370 GN=mltC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.865203	0.126864	0.003443	0.000834	0.000428	0.003238

TMHMM  Annotations     

start	end
7	26