CAZyme Information: MGYG000000932_01388

Basic Information

• Species: UMGS577 sp900543525
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS577; UMGS577 sp900543525
• CAZyme ID: MGYG000000932_01388
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1110		118844.5	4.2428

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000932	1983140	MAG	Germany	Europe

• Gene Location: Start: 181; End: 3513 Strand: +

Full Sequence      

MRKAIAFCLSICLLAVLFLPGVSVSATVQSIVYRATDCIDAENSSKAFAEQEHNWNGTPT
EEGTFSRFDGTEAGDYAAYVLDVQTAGSYTLLIRYRAHETTAAASDLYVNGQKLETSFQQ
TGSANYAYTADMGTVTLAAGKNTLRFEVQSPGKNGTYRLNLFSFTLSYDDGEEPDYNEDG
IPIGTVGGSIGSTGTASSAGVTYNAIESQSAEYSSASFANQTTGAYTFSRFDATEEGAYA
TYILHVQAAGQYKLLVRYRAHETVGKANFYLNGDKQEKTFKSTGAANSYYQTSLGIYTLV
EGDNYIQFKMYEPGSSGAYKLNLVDFTLAEPVEEELNGYTETPGASSDKVVSYPFQSIYK
TSEIFHVKADGVEIPVVAYGSDWYDYAQFSFKDTEQPIEIEVTYASPIKSYSISPLKEEI
TGQASGNTLTFTIDKSLYLILRINGSNKRLVITADPPESDVPAASGEGIFNVTDDAYGAD
RTGKDSSYAALQKAVDDASAYGSISGNPQGVVYVPSGVYFTGSLMLKSNVKLYLEGGAIL
RASRDEDDFAVKGRKNSLGLPITYLIYTENDSTNIKICGRGTVDGDGYNVRALGFALQTL
SPVNTSYFTTDGITYRDSGMWSIVPAWSDHLEFLNIKILNTVKLGEDDGIDICGCQEVVV
RHAIGIMWDDPFSTKAYMGSSGEIAGGWGDGDGEINDNILFDDCVSWTGCYGFKAGQGVS
LDQQNITFRNGTVYECAVGLGIHYKQGGASVRSIAFENIDVENIVHQNDDHKTWFVAYIQ
ASSGTGGPITDVKVKNINVRCASTSTPKLLGKAEGIEISNVSFENITFQGSTGAATTLAQ
MGFTEEFSRFSENCYVINPDNAKTPAEYASSISAGTVQNDTEAETGRALRLNAGGTATFP
GMDFGEGASRLNIRLAAVAGTTVTVALDGAENLIGRAKTVDADGYQHLSIDLKDVSGLHD
LYIASDGAAAFDWVQIYTGATTNPDAEAAAAVDAQILAIGEVVSLSQAEQIAAARAAYEA
LSDAAKALVTALETLEAAEARLAELTVKRGDVDNDGKITVSDVVELRKLIVAGSWTDREF
AAGNLDNSDQNLTVSDVVALRALIVSGTEE

Enzyme Prediction     

No EC number prediction in MGYG000000932_01388.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	506	834	7e-47	0.92

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	1.71e-20	422	765	44	399	Polygalacturonase [Carbohydrate transport and metabolism].
cd04084	CBM6_xylanase-like	5.44e-11	862	975	1	122	Carbohydrate Binding Module 6 (CBM6); many are appended to glycoside hydrolase (GH) family 11 and GH43 xylanase domains. This family includes carbohydrate binding module 6 (CBM6) domains that are appended mainly to glycoside hydrolase (GH) family domains, including GH3, GH11, and GH43 domains. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB6s belonging to this family are Microbispora bispora GghA, a 1,4-beta-D-glucan glucohydrolase (GH3); Clostridium thermocellum xylanase U (GH11), and Penicillium purpurogenum ABF3, a bifunctional alpha-L-arabinofuranosidase/xylobiohydrolase (GH43). GH3 comprises enzymes with activities including beta-glucosidase (hydrolyzes beta-galactosidase) and beta-xylosidase (hydrolyzes 1,4-beta-D-xylosidase). GH11 family comprises enzymes with xylanase (endo-1,4-beta-xylanase) activity which catalyze the hydrolysis of beta-1,4 bonds of xylan, the major component of hemicelluloses, to generate xylooligosaccharides and xylose. GH43 includes beta-xylosidases and beta-xylanases, using aryl-glycosides as substrates. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold.
cd04080	CBM6_cellulase-like	6.85e-08	71	165	53	144	Carbohydrate Binding Module 6 (CBM6); appended to glycoside hydrolase (GH) domains, including GH5 (cellulase). This family includes carbohydrate binding module 6 (CBM6) domains that are appended to several glycoside hydrolase (GH) domains, including GH5 (cellulase) and GH16, as well as to coagulation factor 5/8 carbohydrate-binding domains. CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. The CBM6s are appended to GHs that display a diversity of substrate specificities. For some members of this family information is available about the specific substrates of the appended GH domains. It includes the CBM domains of various enzymes involved in cell wall degradation including, an extracellular beta-1,3-glucanase from Lysobacter enzymogenes encoded by the gluC gene (its catalytic domain belongs to the GH16 family), the tandem CBM domains of Pseudomonas sp. PE2 beta-1,3(4)-glucanase A (its catalytic domain also belongs to GH16), and a family 6 CBM from Cellvibrio mixtus Endoglucanase 5A (CmCBM6) which binds to the beta1,4-beta1,3-mixed linked glucans lichenan, and barley beta-glucan, cello-oligosaccharides, insoluble forms of cellulose, the beta1,3-glucan laminarin, and xylooligosaccharides, and the CBM6 of Fibrobacter succinogenes S85 XynD xylanase, appended to a GH10 domain, and Cellvibrio japonicas Cel5G appended to a GH5 (cellulase) domain. GH5 (cellulase) family includes enzymes with several known activities such as endoglucanase, beta-mannanase, and xylanase, which are involved in the degradation of cellulose and xylans. GH16 family includes enzymes with lichenase, xyloglucan endotransglycosylase (XET), and beta-agarase activities. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. For CmCBM6 it has been shown that these two binding sites have different ligand specificities.
pfam12708	Pectate_lyase_3	3.77e-07	469	543	1	71	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
cd04082	CBM35_pectate_lyase-like	6.31e-07	72	147	33	109	Carbohydrate Binding Module family 35 (CBM35), pectate lyase-like; appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. This family includes carbohydrate binding module family 35 (CBM35) domains that are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. Included in this family are CBM35s of pectate lyases, including pectate lyase 10A from Cellvibrio japonicas, these enzymes release delta-4,5-anhydrogalaturonic acid (delta4,5-GalA) from pectin, thus identifying a signature molecule for plant cell wall degradation. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. Some CBM35s bind their ligands in a calcium-dependent manner, especially those binding uronic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACX65004.1	9.92e-121	350	843	43	549
ASQ97589.1	1.70e-116	336	844	33	534
ADB33990.1	8.66e-116	345	845	28	516
AQW54158.1	4.96e-114	336	844	33	534
BAL91203.1	7.38e-107	342	844	11	497

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2UVE_A	6.32e-08	469	800	156	488	Structureof Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVE_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVF_A Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica],2UVF_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica]
3JUR_A	6.51e-08	477	761	33	349	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
4MXN_A	5.17e-07	490	723	40	247	Crystalstructure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_B Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_C Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_D Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7PZL3	3.13e-11	477	800	68	359	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
P15922	2.61e-07	419	881	111	526	Exo-poly-alpha-D-galacturonosidase OS=Dickeya chrysanthemi OX=556 GN=pehX PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000319	0.999076	0.000154	0.000158	0.000135	0.000135

TMHMM  Annotations     

start	end
5	27