CAZyme Information: MGYG000000933_01180

Basic Information

• Species: CAG-314 sp000437915
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-314; CAG-314; CAG-314 sp000437915
• CAZyme ID: MGYG000000933_01180
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
725		80529.4	8.1331

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000933	1540789	MAG	Germany	Europe

• Gene Location: Start: 16917; End: 19094 Strand: +

Full Sequence      

MIACVTDKDFVKFDAAKMNENRKKAVFKDSQGQSMELDAGKQGRYVSVSELNDYTLNAFV
STEDKRFYKHHGLDLKRIGSALIKNIFSGSYKEGASTITQQLVKNTFLTNKKTLKRKVNE
MFLTLKVEQEYSKKEILEMYLNTIYFGANAYGIETASKTYFGKSASELTLAESAGLAGML
KAPNNYSPVYNPDKYISRRNLVLNLMRENGFIDDNLCEAAKEEKIDLSAVDTRAATEKSY
LDAALIEACLILNSKQEQMLNKPYIVKTFYDGGLQAALKSSMNKDVKTLSGDSASRCAYV
VNNITGGVSSYIGYSKYNIYNIKRQVGSAIKPLAVYCPALDLKAITPATPVLDEKTDFDG
YSPNNFNDKYYGWTTMRRAVADSMNTAAVKVLNSIGVSASIGYLNKNGIKTSEQDRNLSI
ALGSFYNGVSLQELLAGYLTLANSGVYKSVGFVDEISLNGKVLYKKNTENGARVFRTESA
YLMTDMLKTVADSGTAKVLSDIGFDVAGKTGTAGVKSGNTDALFCGYDTRNTYLFWLGAE
SSDPLGSEITGNASARMAKSFLESAYTTFPSNFARPADIVEKKLDKKTFSEKHALAVAGV
DCKQNEAFTELFEIDNCPAVVAETPENDLPPEIKIVCENGIPVIFADNLKDNQRLFREFE
GKETKLKTEEIDGVVFATDKKAAENGIYAYYVKQDGKIVSNVEFYYKKVRIKEKENRKWF
ENWFW

Enzyme Prediction     

No EC number prediction in MGYG000000933_01180.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	40	206	1.9e-68	0.9378531073446328

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	1.05e-159	42	566	1	529	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	4.48e-145	35	582	68	613	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	6.04e-117	40	588	63	742	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
TIGR02071	PBP_1b	1.30e-86	38	588	142	704	penicillin-binding protein 1B. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in E. coli and other Proteobacteria, designated penicillin-binding protein 1B. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam00912	Transgly	1.18e-84	44	207	14	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGX66646.1	3.85e-107	29	615	50	637
AMM96744.1	5.40e-107	29	581	50	609
QLI78926.1	7.57e-107	29	581	50	609
AOZ87792.1	7.57e-107	29	615	50	637
AIZ59637.1	1.49e-106	29	615	50	637

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZG8_B	2.93e-62	127	543	3	436	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
3DWK_A	8.27e-56	29	579	12	602	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
3ZG7_B	7.69e-55	127	543	3	436	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]
3UDF_A	3.40e-54	40	575	36	725	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]
2OLU_A	7.75e-52	13	579	6	611	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38050	2.17e-95	46	600	70	636	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
P39793	1.19e-82	14	673	62	743	Penicillin-binding protein 1A/1B OS=Bacillus subtilis (strain 168) OX=224308 GN=ponA PE=1 SV=1
A5I6G4	1.26e-75	25	612	57	689	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) OX=441771 GN=pbpA PE=3 SV=1
A7FY32	1.26e-75	25	612	57	689	Penicillin-binding protein 1A OS=Clostridium botulinum (strain ATCC 19397 / Type A) OX=441770 GN=pbpA PE=3 SV=1
A7GHV1	1.16e-74	25	612	57	689	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) OX=441772 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000933_01180.