CAZyme Information: MGYG000000934_01265

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000000934_01265
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
312		34173.65	6.6502

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000934	1650668	MAG	Germany	Europe

• Gene Location: Start: 1895; End: 2833 Strand: -

Full Sequence      

MGYVHGVNLADELDEVEGFAGAGEPCAAASLASEPQPGQPAMPAWAQRVTAVGETGMLSP
ASVSPVSAPSAPALSADASISSRRAPVVCAVSGSGYLISASVIEGMHGWQFHTLTEDIQF
TTFCAIHGIRIGYAPAEFFDEQPVTFKASWKQRMRWTKGFYQVFFTYGKHLVKSTFRYHR
FAAYDMFMTIAPGMLLSLISMLANATFLIVGGLSHGFLATEVEMQACAASLILTFAMMYQ
TFFILALLTTIFEYKHIHCAQKWRLVTNLFTFPIFMFSYIPITVAALFLKVDWVPTQHAV
SVTLDEVMQGAK

Enzyme Prediction     

No EC number prediction in MGYG000000934_01265.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1215	BcsA	9.82e-15	91	293	214	419	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
pfam13632	Glyco_trans_2_3	4.31e-09	88	211	69	189	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
PRK11204	PRK11204	1.40e-07	91	248	209	362	N-glycosyltransferase; Provisional
cd06438	EpsO_like	2.19e-05	89	120	153	183	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
cd06427	CESA_like_2	8.20e-05	101	170	171	240	CESA_like_2 is a member of the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, Glucan Biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA33195.1	6.47e-154	89	312	208	431
ATP53496.1	9.18e-154	89	312	208	431
AZH69681.1	3.72e-153	89	312	208	431
AEB07123.1	7.49e-114	89	312	208	431
AKT50107.1	3.97e-104	89	312	205	428

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	9.28e-07	88	159	207	279	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
196	218
230	252
267	289