CAZyme Information: MGYG000000934_01513

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000000934_01513
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
278		32556.43	8.6423

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000934	1650668	MAG	Germany	Europe

• Gene Location: Start: 1125; End: 1961 Strand: -

Full Sequence      

MHQENGGHGIAVLSGLREAQGTYYKVVDSDDWLDGAALSTMLSILRGFEERDQRVDLFIS
NYVYEKVYEGTHTAIGYKFALPRKKIFTWDQIGHFRLDQNLLMHSLCYRTDVLRASNLPM
PPHTFYVDNIYAYVPLPRCKTMYYADIDLYRYFIGREGQSVNEATMVKRLDQQFRVTRIM
MESFHLYRDVESPRLCSYMMSYFTLMMAVCSVFTKLSDEEGAGERLMTLWKDLKAYDERM
YRHARYGVVGFFTNLRGRAGDKTTIGIYRLASKIFKFN

Enzyme Prediction     

No EC number prediction in MGYG000000934_01513.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00535	Glycos_transf_2	9.74e-05	2	97	60	158	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	0.005	2	66	59	121	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZH69861.1	6.63e-192	1	278	66	343
ATP53313.1	7.72e-191	1	278	66	343
QIA32967.1	1.56e-190	1	278	66	343
QWT18263.1	2.89e-149	1	278	77	354
AEB06858.1	2.76e-142	1	278	66	343

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000934_01513.