CAZyme Information: MGYG000000935_01168

Basic Information

• Species: UMGS1532 sp900552605
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1532; UMGS1532 sp900552605
• CAZyme ID: MGYG000000935_01168
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
814		93587.82	5.4877

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000935	1747376	MAG	Germany	Europe

• Gene Location: Start: 555; End: 2999 Strand: -

Full Sequence      

MAIKLKKITVEDVVAPVGIKTINPRFSWQLESDKNGAKQLGYRIIVHEWIHEEMWDTGFV
ETENCYNIEYRGAALARDTQYYVKVLIKTTEGDIETETTFRTGLFDYQPPHIGWIRPSVS
EKEYSFSPYFRREFALKSDEIAFATLYITSRGWYDAYLNGKPICEDAVMEPACCPKFNIS
YLKAYDITNDLRDGYNAIAVQLGNGYSQNFRFGNAYHRGKRLWALLSITYTDGTYQHICT
DENWKWSRSPVVFDHIYDGEWYDARKEQPGWNRPGFNDAAWENAVRADFSETIKPVFTPP
VKILGTRPAAGITKIGENKFIYDFKYNGSGVLKIKVKGDPGTEVRMLHAENLLPNGMLQT
WTNRNAEVTDRYILKGDGEEIYQPKFTYHCFRYVEFTVTGNAEIVSAEALVYGTDMFSES
HFECSSDMLNRIQQNFIRTLKTNFMSWPTDTGVRDERTPCSMDIQVYEEMAMQNCNAHNY
FETWLAKGIATDGNTDWSGDDITLPWLMYKYYGDKQLLRRIYPKLRALANSFYQMHKLNG
FKKAFGDWAAPNPTNEYEDSFSVPQETCYAMFFKQMQMMKEIAIALCENEDIATYEHFAK
IAKDEYMKFYDESTHLFSEGKQTPNLLAIANGLVEGKQKDDVLTALIKSIREKDNSHLDT
GIFGTRKLIEVLSETADGRALVYDILHQTTYPSFGHQIVGRDATTAWEQWYNLQGMMSCS
HSMFCGIGADFYKYLAGIKNAENCYEKAIIEPIADERITSVNCKLETVRGVFEVKWTREN
GTMKLWCKIPVGSRATVVLPNGETHDVESGIYSF

Enzyme Prediction     

No EC number prediction in MGYG000000935_01168.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	312	799	2.2e-112	0.998015873015873
CBM67	114	287	7.2e-38	0.9375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	3.64e-55	422	735	6	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	2.35e-43	140	303	2	170	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	5.90e-27	313	410	1	96	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.84e-12	745	814	9	78	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTI90329.1	6.99e-147	9	800	35	854
ATL88162.1	7.56e-145	9	809	47	876
AQW55514.1	5.97e-144	9	800	46	865
BBJ37814.1	2.45e-143	9	811	35	866
ASR00736.1	5.38e-143	9	800	26	845

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	2.99e-113	11	800	38	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	1.36e-96	131	800	306	995	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	3.04e-88	2	814	1	863	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	6.07e-96	131	800	306	995	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KPL4	7.61e-83	16	803	43	910	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
T2KNB2	9.29e-82	16	808	47	887	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	7.59e-80	11	800	38	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000935_01168.