CAZyme Information: MGYG000000937_00764

Basic Information

• Species: UMGS403 sp900541975
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS403; UMGS403 sp900541975
• CAZyme ID: MGYG000000937_00764
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
507		54096.6	9.193

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000937	2265948	MAG	Germany	Europe

• Gene Location: Start: 107130; End: 108653 Strand: +

Full Sequence      

MGLTGKNNEEKAWNFLKGKIKNDFGVSGLMGELFAESGLNPQNLQNSYEKKLGFTDATYT
AAVDSGSYANFVHDSAGYGVAQWTFWSRKEALLNYVRALGASIGDLEAQLGFLYKELSES
YPSVLAALKTATSVRAASDKVLTDFERPADQSEAVKIKRASYGQTYYDKYAKAAASTPSE
GGNNMSNSPLVNCTVKSPNHSGKRTHSIDTLTPHCVVGQLTAEGIGSCFPAGREASCNYG
IGKDARVVLVVDECNRSWCSSSNSNDQRAVTIECASDKTDPYAMNSAVYEKLIELCADIC
KRNGKNKVLWLGSKEKTLAYTPKSNEMVLTAHRWFANKSCPGDWLYSRYGELADRINALL
GTGGSSGSGGGSTGGSSSSGSVLYYVQSGAYSQKANADAQAARLKAAGFEVLIKKVGNLY
KVQTGAYSKKANADAQVSKLKAKGFDAFVTTNGGGTAASGDTPKKSNTEIAKEVIAGKWG
NGADRKKRLEAAGYNYAAVQKIVNSML

Enzyme Prediction     

No EC number prediction in MGYG000000937_00764.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam18013	Phage_lysozyme2	3.64e-27	7	170	1	139	Phage tail lysozyme. This domain has a lysozyme like fold. It is found in the tail protein of various phages probably giving them the ability to degrade the host cell wall peptidoglycan layer.
pfam08230	CW_7	9.20e-19	469	507	2	40	CW_7 repeat. This domain was originally found in the C-terminal moiety of the Cpl-7 lysozyme encoded by the Streptococcus pneumoniae bacteriophage Cp-7. It is also found in the cell wall hydrolases of human and life-stock pathogens. CW_7 repeats make up a cell wall binding motif.
pfam01510	Amidase_2	4.36e-15	208	343	2	121	N-acetylmuramoyl-L-alanine amidase. This family includes zinc amidases that have N-acetylmuramoyl-L-alanine amidase activity EC:3.5.1.28. This enzyme domain cleaves the amide bond between N-acetylmuramoyl and L-amino acids in bacterial cell walls (preferentially: D-lactyl-L-Ala). The structure is known for the bacteriophage T7 structure and shows that two of the conserved histidines are zinc binding.
smart01095	Cpl-7	5.61e-14	469	507	3	41	Cpl-7 lysozyme C-terminal domain. This domain was originally found in the C-terminal moiety of the Cpl-7 lysozyme encoded by the Streptococcus pneumoniae bacteriophage Cp-7. It is assumed that these repeats represent cell wall binding motifs although no direct evidence has been obtained so far.
pfam05036	SPOR	2.06e-13	384	451	5	76	Sporulation related domain. This 70 residue domain is composed of two 35 residue repeats found in proteins involved in sporulation and cell division such as FtsN, DedD, and CwlM. This domain is involved in binding peptidoglycan. Two tandem repeats fold into a pseudo-2-fold symmetric single-domain structure containing numerous contacts between the repeats. FtsN is an essential cell division protein with a simple bitopic topology, a short N-terminal cytoplasmic segment fused to a large carboxy periplasmic domain through a single transmembrane domain. These repeats lay at the periplasmic C-terminus. FtsN localizes to the septum ring complex.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFB75734.1	1.74e-186	1	367	1	369
QUO22979.1	5.31e-183	1	367	1	369
ADB89215.1	4.98e-77	183	361	9	190
CBL18646.1	1.81e-74	186	363	6	184
AFB76124.1	2.80e-53	182	361	3	180

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000937_00764.