CAZyme Information: MGYG000000941_00448

Basic Information

• Species: CAG-1031 sp000431215
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-1031; CAG-1031 sp000431215
• CAZyme ID: MGYG000000941_00448
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
754	MGYG000000941_5|CGC2	83661.06	6.1759

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000941	2489616	MAG	Germany	Europe

• Gene Location: Start: 47306; End: 49570 Strand: -

Full Sequence      

MKRFLFLPAVAAAAAVAFAAPGARTIVETDAYRWQGDTLYQDEFKAWAVSPYEIRSTYKG
RPHYFMPVEQTWKRKNDLSAYPRLTTPNRLHQAVFNMGLDEMVNAVEPDTTLRTGKEWAG
VWTRDVSYSIILSMAVLQPEASMISLMKKVNPSGQIIQDTGSGGAWPVSTDRMVWVLAAW
EIYKVTGSREWLEKVYPIAVRSIAKDDATVRSERGLVKGETSFIDWREQSYPRWMQTADI
SQSEAMGTNVMYAAALKAVGEMARILGHKAEAESYFKESAKLAEAIDRTFYVDRLGLWGM
YTYGRDAMIVNPRAETLGLALSILYDIAPEKRQKQFSENNPTTPYGPAIFFPQISDMPSY
HNNALWPFVASYWTLAQAKAGNEDGVVEGIGSVVRPAALFATNKENFNLDNGDYFTELNS
SNMLWSLSGNLALTMKILFGLHYEADGLLIKPFVPEAFRGERSLDNISYRGATLNITVRG
YGCNVASMTLNGKPLAPGELIPAKKLRGTCDIVVEMDNKPIPVMGIRATANKKAPLTPVA
WLEDGNLVWNPIEYIAEYVVLQDGHEVGHTRRTSWPVGRQSGVWQVYGVSAEGIPGFASE
PRSTRRRARFEFSGEGDAMESPEISYPARESLDGSHRGFVEIDRTSAPAKAVIRVDAPGE
YTLAFRYANGNGPVNTENKCCVRAVFVDGVKAGTAVMPTRGVANWPDWGMSNTVRLPLSA
GEHTVELRYLPEDENMNISTNHALVDCVVVEHAL

Enzyme Prediction     

No EC number prediction in MGYG000000941_00448.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04083	CBM35_Lmo2446-like	3.51e-16	637	750	26	125	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
pfam17389	Bac_rhamnosid6H	5.32e-08	162	334	78	244	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG3408	GDB1	2.80e-07	118	384	281	555	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
cd04082	CBM35_pectate_lyase-like	1.63e-06	655	727	42	108	Carbohydrate Binding Module family 35 (CBM35), pectate lyase-like; appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. This family includes carbohydrate binding module family 35 (CBM35) domains that are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. Included in this family are CBM35s of pectate lyases, including pectate lyase 10A from Cellvibrio japonicas, these enzymes release delta-4,5-anhydrogalaturonic acid (delta4,5-GalA) from pectin, thus identifying a signature molecule for plant cell wall degradation. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. Some CBM35s bind their ligands in a calcium-dependent manner, especially those binding uronic acids.
cd02795	CBM6-CBM35-CBM36_like	1.50e-05	653	738	41	119	Carbohydrate Binding Module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules. This alignment model also contains the C-terminal domains of bacterial insecticidal toxins, where they may be involved in determining insect specificity through carbohydrate binding functionality.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWG27199.1	2.99e-199	69	748	212	888
AYA38918.1	2.98e-198	72	746	236	908
AKQ46615.1	3.21e-198	71	746	227	898
QEC42842.1	5.48e-197	72	746	217	888
ARS34527.1	1.69e-196	72	746	223	892

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000348	0.998766	0.000235	0.000218	0.000225	0.000189

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000941_00448.