CAZyme Information: MGYG000000941_01886

Basic Information

• Species: CAG-1031 sp000431215
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-1031; CAG-1031 sp000431215
• CAZyme ID: MGYG000000941_01886
• CAZy Family: CE1
• CAZyme Description: Carbohydrate acetyl esterase/feruloyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374		41097.77	9.1509

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000941	2489616	MAG	Germany	Europe

• Gene Location: Start: 8772; End: 9896 Strand: -

Full Sequence      

MPGMQYLKKLLIAITVAAAACQAFAAAPKQPKSGVVNDDATVSLAVYAPKAASVTVGGDL
APTKMTRGADGIWRGRTKSLRPDYYTYFFNIDGVRTIDPANAFTERNEMYLSNYVVTDPE
LRSQDVPHGTVAKVWGPDGRRMTVYTPAGFDPRSDRRYPVLYLLHGLGGDENAWPELGRA
PYILDNMIAAGQVEPMIVVMPNGNIAHKAAPGDNPGAPAQPVSRPPRTMNGEFEASFPAI
VEWVDSHYPTNTDRASRALAGLSMGGFHTIHIARANPAMFGYIGSFSSFLHPRKYSDSKA
YDNPGPALRALADAKPLLLWVGIGKTDFLARENKEMLAEFDKAGLNYEYHSSEGGHTWKN
WRDYLRLFLPKLFK

Enzyme Prediction     

No EC number prediction in MGYG000000941_01886.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	140	370	3e-53	0.9383259911894273

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2382	Fes	1.35e-35	65	374	3	297	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
pfam00756	Esterase	1.01e-26	139	362	5	236	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
cd11294	E_set_Esterase_like_N	3.21e-21	41	115	2	80	N-terminal Early set domain associated with the catalytic domain of putative esterases. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
COG0627	FrmB	1.42e-17	135	370	30	306	S-formylglutathione hydrolase FrmB [Defense mechanisms].
cd02858	E_set_Esterase_N	4.25e-13	46	100	7	61	N-terminal Early set domain associated with the catalytic domain of esterase. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXN65677.1	8.53e-105	36	374	34	396
QUB44956.1	2.68e-101	33	374	19	387
ALJ59664.1	6.27e-101	36	374	34	393
ADY36651.1	4.03e-100	36	374	34	397
QNT09071.1	1.10e-99	7	374	1	407

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RZN_A	8.14e-68	27	374	18	386	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
7B5V_A	5.42e-46	46	374	52	386	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6NE9_A	2.18e-41	36	374	44	382	ChainA, Isoamylase protein [Bacteroides intestinalis],6NE9_B Chain B, Isoamylase protein [Bacteroides intestinalis]
6MOT_A	7.48e-40	36	374	21	359	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]
6MOU_A	1.18e-39	36	374	42	380	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393],6MOU_B Chain B, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EXZ4	1.56e-36	46	374	341	670	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
P31471	4.98e-31	36	374	43	389	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
D5EY13	4.20e-28	35	374	396	726	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P10478	1.36e-25	140	369	65	273	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
P51584	6.78e-07	140	373	841	1075	Endo-1,4-beta-xylanase Y OS=Acetivibrio thermocellus OX=1515 GN=xynY PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000467	0.588036	0.410687	0.000325	0.000263	0.000212

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000941_01886.