CAZyme Information: MGYG000000941_02104

Basic Information

• Species: CAG-1031 sp000431215
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-1031; CAG-1031 sp000431215
• CAZyme ID: MGYG000000941_02104
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375		41837.39	9.1857

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000941	2489616	MAG	Germany	Europe

• Gene Location: Start: 8278; End: 9405 Strand: +

Full Sequence      

MRYFISAGEASGDLHASRLIASLREKDPEARFTFLGGDLMAAEAGHRPLLHFRDMAFMGF
SEVIRNFGRIGRNLALARETLEKERPDALIVVDYPDFNLKLAATAKKLGIPVYYFIPPKV
WAWKKWRIRSLRRLCRRLLCIFPFEVDFYKREGVDVDYVGNPSVEEIDSQIAALPPAEDY
RYQNDLTSRPLLLLVPGSRRSELRNNLPVMASVARRRRDMQAVVAGAPGIDMEFYRSLTT
LPVIYGETVGLMANARAALVTSGTATLECALAGTPQVACYRANGSRLSYSIMRRLLNVDY
VTLPNLIAGAPVVPEMLLHYCTPEAVGLRLAGIVDDGPEREKQLEGYAVIRHRLGEAGAA
RRAADIIINDLRNNG

Enzyme Prediction     

No EC number prediction in MGYG000000941_02104.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	354	6.6e-107	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.26e-95	1	354	2	359	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	9.70e-92	1	354	2	362	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.19e-75	4	343	2	348	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	7.93e-66	1	343	1	354	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	5.08e-42	1	325	2	308	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD36425.1	2.26e-140	1	371	1	374
QQR08529.1	1.18e-136	1	367	1	370
ASB37800.1	1.18e-136	1	367	1	370
ANU64105.1	1.18e-136	1	367	1	370
QCP71596.1	2.30e-122	1	371	1	392

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	4.45e-40	7	368	13	378	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	4.45e-40	7	368	13	378	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	7.60e-81	2	371	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
B4UHR6	1.07e-67	5	372	13	383	Lipid-A-disaccharide synthase OS=Anaeromyxobacter sp. (strain K) OX=447217 GN=lpxB PE=3 SV=1
B8JE78	1.07e-67	5	372	13	383	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=lpxB PE=3 SV=1
Q2IL69	3.01e-67	5	372	13	383	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=lpxB PE=3 SV=1
Q2LVL8	8.40e-67	5	374	8	381	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000078	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000941_02104.