CAZyme Information: MGYG000000942_01467

Basic Information

• Species: UMGS692 sp900544545
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-314; UMGS692; UMGS692 sp900544545
• CAZyme ID: MGYG000000942_01467
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
312		34499.49	9.1847

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000942	1713288	MAG	Germany	Europe

• Gene Location: Start: 203; End: 1141 Strand: -

Full Sequence      

MRKSCVLFIIAALILSAAGLRFFPSVNSSSDMRTDGKFSSDFCGGKVFLSEESVSAEGKP
LPAIMYHSVNKANIGDYVIHPSELERDFRNVKKLGFTPIFAREAADFVGKGFPLPEKPIL
ITFDDGFYNNLSFVLPLLKKYGYKAVIAVVGSFTDKEKGQRQSDYYSNLNREQIKLLSES
GFVEIADHTYDLHGFKNGRKGVCRKKGESFSAYRELLLKDLAKNGELLLSACGKAPTTFV
YPYGAYSADTPEILAEAGFGIALTCNETVSVLKKGCNPYLVGRFNRSGKADSDAFFAKLS
REIEKARRRTDS

Enzyme Prediction     

No EC number prediction in MGYG000000942_01467.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE4	113	261	8.7e-25	0.9153846153846154

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10964	CE4_PgaB_5s	7.32e-38	114	264	1	170	N-terminal putative catalytic polysaccharide deacetylase domain of bacterial poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB, and similar proteins. This family is represented by an outer membrane lipoprotein, poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase (PgaB, EC 3.5.1.-), encoded by Escherichia coli pgaB gene from the pgaABCD (formerly ycdSRQP) operon, which affects biofilm development by promoting abiotic surface binding and intercellular adhesion. PgaB catalyzes the N-deacetylation of poly-beta-1,6-N-acetyl-D-glucosamine (PGA), a biofilm adhesin polysaccharide that stabilizes biofilms of E. coli and other bacteria. PgaB contains an N-terminal NodB homology domain with a 5-stranded beta/alpha barrel, and a C-terminal carbohydrate binding domain required for PGA N-deacetylation, which may be involved in binding to unmodified poly-beta-1,6-GlcNAc and assisting catalysis by the deacetylase domain. This family also includes several orthologs of PgaB, such as the hemin storage system HmsF protein, encoded by Yersinia pestis hmsF gene from the hmsHFRS operon, which is essential for Y. pestis biofilm formation. Like PgaB, HmsF is an outer membrane protein with an N-terminal NodB homology domain, which is likely involved in the modification of the exopolysaccharide (EPS) component of the biofilm. HmsF also has a conserved but uncharacterized C-terminal domain that is present in other HmsF-like proteins in Gram-negative bacteria. This alignment model corresponds to the N-terminal NodB homology domain.
cd10918	CE4_NodB_like_5s_6s	3.09e-37	118	288	1	156	Putative catalytic NodB homology domain of PgaB, IcaB, and similar proteins which consist of a deformed (beta/alpha)8 barrel fold with 5- or 6-strands. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes bacterial poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB, hemin storage system HmsF protein in gram-negative species, intercellular adhesion proteins IcaB, and many uncharacterized prokaryotic polysaccharide deacetylases. It also includes a putative polysaccharide deacetylase YxkH encoded by the Bacillus subtilis yxkH gene, which is one of six polysaccharide deacetylase gene homologs present in the Bacillus subtilis genome. Sequence comparison shows all family members contain a conserved domain similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, which consists of a deformed (beta/alpha)8 barrel fold with 6 or 7 strands. However, in this family, most proteins have 5 strands and some have 6 strands. Moreover, long insertions are found in many family members, whose function remains unknown.
cd10969	CE4_Ecf1_like_5s	5.67e-35	81	285	1	201	Putative catalytic NodB homology domain of a hypothetical protein Ecf1 from Escherichia coli and similar proteins. This family contains a hypothetical protein Ecf1 from Escherichia coli and its prokaryotic homologs. Although their biochemical properties remain to be determined, members in this family contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
cd10966	CE4_yadE_5s	8.49e-35	115	295	1	164	Putative catalytic polysaccharide deacetylase domain of uncharacterized protein yadE and similar proteins. This family contains an uncharacterized protein yadE from Escherichia coli and its bacterial homologs. Although its molecular function remains unknown, yadE shows high sequence similarity with the catalytic NodB homology domain of outer membrane lipoprotein PgaB and the surface-attached protein intercellular adhesion protein IcaB. Both PgaB and IcaB are essential in bacterial biofilm formation.
PRK14582	pgaB	1.14e-27	59	309	42	315	poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFS77609.1	5.30e-37	47	273	8	243
AAM25723.1	1.95e-36	61	270	40	265
AIS53446.1	6.28e-33	61	270	35	260
ARI76505.1	2.47e-29	51	275	216	447
AFS79569.1	2.61e-29	44	264	13	238

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5BU6_A	4.49e-25	77	264	36	243	Structureof BpsB deaceylase domain from Bordetella bronchiseptica [Bordetella bronchiseptica RB50],5BU6_B Structure of BpsB deaceylase domain from Bordetella bronchiseptica [Bordetella bronchiseptica RB50]
3VUS_A	7.71e-18	63	264	10	232	Escherichiacoli PgaB N-terminal domain [Escherichia coli K-12],3VUS_B Escherichia coli PgaB N-terminal domain [Escherichia coli K-12]
4WCJ_A	1.37e-17	57	283	33	245	Structureof IcaB from Ammonifex degensii [Ammonifex degensii KC4]
4F9D_A	4.74e-17	63	264	14	236	Structureof Escherichia coli PgaB 42-655 in complex with nickel [Escherichia coli K-12],4F9D_B Structure of Escherichia coli PgaB 42-655 in complex with nickel [Escherichia coli K-12]
4F9J_A	6.38e-17	63	264	14	236	Structureof Escherichia coli PgaB 42-655 in complex with iron [Escherichia coli K-12],4F9J_B Structure of Escherichia coli PgaB 42-655 in complex with iron [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P75906	1.50e-16	52	264	36	273	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Escherichia coli (strain K12) OX=83333 GN=pgaB PE=1 SV=1
Q8XAR3	3.65e-16	63	264	51	273	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Escherichia coli O157:H7 OX=83334 GN=pgaB PE=3 SV=1
P94361	1.41e-14	61	299	65	275	Putative polysaccharide deacetylase YxkH OS=Bacillus subtilis (strain 168) OX=224308 GN=yxkH PE=3 SV=1
P31666	4.78e-10	61	283	170	387	Uncharacterized protein YadE OS=Escherichia coli (strain K12) OX=83333 GN=yadE PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.636839	0.343875	0.017040	0.000805	0.000443	0.000999

TMHMM  Annotations     

start	end
5	24