CAZyme Information: MGYG000000943_00962

Basic Information

• Species: Eubacterium_R sp900555015
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Eubacterium_R; Eubacterium_R sp900555015
• CAZyme ID: MGYG000000943_00962
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
816		93254.85	7.2514

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000943	1209559	MAG	Germany	Europe

• Gene Location: Start: 48956; End: 51406 Strand: -

Full Sequence      

MYKKTLNGIWKITLCSSAKQCEAQVPVSDYNALLKADIIDDPFYGENETKCLYIAEEDKI
FERTFSVDEENLNYKNIVLSCDMLDTLAEIFINEKPVAKSQNAYVPFKKNVKEFLALGEN
SIKILFKSPVNYVKERQKKNPLPPNANGINGVPYIRKPACHFGWDWGINLPFSGIIKDID
LLLYDDAVLDFDVNQHIDNGKATVTVDLECCGTPDVNGKIICPNGNEISLNFKNNHSSVV
IENPELWWTRELSGRETQPLYEIKVNDISKKIGIRTVELNRSADEYGNNFQFVLNGVPVF
AKGSNLIPSDAVGDRICKKSHEKTVEDAIKANFNMIRVWGGGYYADDDLCSLCDEKGILI
WQDFMFACLMYPFYDEEFLSSVKAEVKSNVKRMKSHPSLALWCGNNEIEFMFSYMPEKLK
IVQWYKKFFYEILPGEIRKADADTPYIETSPIGKGFRKNITGDACGDTHMWHVWHGSKNL
KYYRKRLTRFCSEYGMESLPSIDCIRSFADDSELDLYSKTMLFHQKCLSGNGKMLYYLLE
RFYAPVKFDDLIYLTGVVQMECIRDATEHFRRHKGRCNGSLWWQYNDCWGAPSWSSVDYS
GKWKPLMYASKQFNAPFTLSICDNKNSVDIFVLNDLLQNKNYKIVYGAVEFNGNVVFEKE
VQGVSAAGKSVKAVSFSTVGLNKKRTSIFAKLYCDDELICKKTAVLLPERKLVLDKAKLS
VLVTDNKISIKSNTFARGVYIDVLGSNQVLSQNGFDIEAGETVDVYLEEKAEPSSVRVKC
VNNIEFDKSKFKRFLKRFSFSIKPENIVNRIYYSVS

Enzyme Prediction     

No EC number prediction in MGYG000000943_00962.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	735	1.8e-88	0.761968085106383

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.67e-80	3	616	12	631	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam00703	Glyco_hydro_2	1.16e-06	176	275	3	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam17753	Ig_mannosidase	1.71e-05	716	783	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam17786	Mannosidase_ig	0.001	626	697	1	74	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ98156.1	8.18e-185	1	808	1	848
AUG59052.1	1.21e-177	6	769	5	793
QGH33887.1	1.46e-164	1	771	1	793
QEH70285.1	2.38e-164	6	757	6	785
QNF27003.1	4.46e-164	1	776	1	804

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	2.35e-123	5	771	7	836	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	2.41e-123	5	771	7	836	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	1.69e-122	5	771	5	834	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	1.73e-122	5	771	7	836	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
5N6U_A	5.19e-122	6	744	29	780	Crystalstructure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q95327	1.11e-100	5	755	24	844	Beta-mannosidase OS=Capra hircus OX=9925 GN=MANBA PE=1 SV=1
Q29444	5.81e-100	5	631	24	705	Beta-mannosidase OS=Bos taurus OX=9913 GN=MANBA PE=1 SV=1
O00462	1.59e-93	5	636	24	710	Beta-mannosidase OS=Homo sapiens OX=9606 GN=MANBA PE=1 SV=3
Q4FZV0	4.40e-92	5	642	24	714	Beta-mannosidase OS=Rattus norvegicus OX=10116 GN=Manba PE=2 SV=1
Q8K2I4	1.53e-89	5	616	24	690	Beta-mannosidase OS=Mus musculus OX=10090 GN=Manba PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.997562	0.002440	0.000030	0.000003	0.000002	0.000003

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000943_00962.