CAZyme Information: MGYG000000943_01045

Basic Information

• Species: Eubacterium_R sp900555015
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Eubacterium_R; Eubacterium_R sp900555015
• CAZyme ID: MGYG000000943_01045
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
642		74586.89	6.0653

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000943	1209559	MAG	Germany	Europe

• Gene Location: Start: 20385; End: 22313 Strand: +

Full Sequence      

MYKLESNKLICEFENENKNFHISKIINKCSKSDFIPDGNSAEFVIKFTNGKKISSNDLEI
EKVDETENKLTISFKENLDIKAKLQYWIHKDQNTVCKQLFLTQKSTTPIDYIELESTGVA
NAHSNFSAKIVEGGEIPAFWSMLGQPIYIDSLFYGCEFPMTENRIINDVATVRYYLGKTV
GNDFKCPITIIGGGLNDSLAGVRDAFFDYIDFISVPAPLRFQYNSWYDYMKDITEENIMV
SFAEIHKQLEAHGAPQLDAYVVDDGWPNTKAGFWSFNKKFPNKLTKVTELCKSMNSHFGL
WLGPRGGYTRPDRIARKMQFAKNGYLNRQAKDICVASSKYIDKLNDFLIETTKEFDIDYW
KLDGFCLKACKNKKHDHAVGGYEDMYFVTDMWEKWIKSYEKLREVNPSLWINMTCYVNVS
PWWLQWVNSLWVQNSGDIGFAKNLDKQAQVDKEITFRDGRYYDCLCTRALQIPLKNLYNH
EPIYGNTAKVEYTDEEFKKYIYWCTVRGQALNELHLSANMMNESKWNSLSEAMNWQKENF
EILKNAVFVGENPEENNIYGYISWDKEGNGIIALRNPNDKKEEFILSLDDSIATPRNLIR
GKRSNIYCESIMAREITYSYKDIKNVILKPFEILIFKIENNA

Enzyme Prediction     

No EC number prediction in MGYG000000943_01045.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	8.68e-10	223	380	6	171	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
COG3345	GalA	5.68e-05	216	304	291	377	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd06592	GH31_NET37	9.79e-05	222	364	4	151	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
pfam02065	Melibiase	0.002	224	304	46	126	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO70357.1	1.44e-141	12	637	46	723
QUT26415.1	1.04e-134	35	637	72	723
SQG39183.1	2.19e-122	53	642	285	922
ATD48595.1	2.19e-122	53	642	285	922
ALG48827.1	4.17e-122	53	642	285	922

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000943_01045.