CAZyme Information: MGYG000000950_01218

Basic Information

• Species: CAG-269 sp900553125
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-269; CAG-269 sp900553125
• CAZyme ID: MGYG000000950_01218
• CAZy Family: CE4
• CAZyme Description: Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
266		31625.99	6.8656

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000950	1578561	MAG	China	Asia

• Gene Location: Start: 25431; End: 26231 Strand: +

Full Sequence      

MKNIVKSMLLLSLIILVFVVLYLYKNPKIAVLCYHNIATQDEKNNFPDESDWTITTDNFK
EQLDYLKNNNYKTLTMDEFYRWKNKELNLPYKSVLITFDDGFLSNYEYAFKLLKEYNMNA
TVFVVGSFIENSTQNTWDGNIKTYMTKDILNNIELEYPNIEIYSHSYNLHYQGAINQDEN
ILENDINNFNDFYKKTDIFCYPFGKYNEKIKNVLKDNNFKLAFKYGPNKNDYKKAGRSDN
NFEIPRLNVSHGMSIFKFGLRLLMYN

Enzyme Prediction     

No EC number prediction in MGYG000000950_01218.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE4	88	222	6.8e-23	0.9230769230769231

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10966	CE4_yadE_5s	2.82e-41	90	258	1	164	Putative catalytic polysaccharide deacetylase domain of uncharacterized protein yadE and similar proteins. This family contains an uncharacterized protein yadE from Escherichia coli and its bacterial homologs. Although its molecular function remains unknown, yadE shows high sequence similarity with the catalytic NodB homology domain of outer membrane lipoprotein PgaB and the surface-attached protein intercellular adhesion protein IcaB. Both PgaB and IcaB are essential in bacterial biofilm formation.
cd10969	CE4_Ecf1_like_5s	2.57e-37	56	249	1	202	Putative catalytic NodB homology domain of a hypothetical protein Ecf1 from Escherichia coli and similar proteins. This family contains a hypothetical protein Ecf1 from Escherichia coli and its prokaryotic homologs. Although their biochemical properties remain to be determined, members in this family contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
cd10918	CE4_NodB_like_5s_6s	2.14e-36	93	252	1	157	Putative catalytic NodB homology domain of PgaB, IcaB, and similar proteins which consist of a deformed (beta/alpha)8 barrel fold with 5- or 6-strands. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes bacterial poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB, hemin storage system HmsF protein in gram-negative species, intercellular adhesion proteins IcaB, and many uncharacterized prokaryotic polysaccharide deacetylases. It also includes a putative polysaccharide deacetylase YxkH encoded by the Bacillus subtilis yxkH gene, which is one of six polysaccharide deacetylase gene homologs present in the Bacillus subtilis genome. Sequence comparison shows all family members contain a conserved domain similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, which consists of a deformed (beta/alpha)8 barrel fold with 6 or 7 strands. However, in this family, most proteins have 5 strands and some have 6 strands. Moreover, long insertions are found in many family members, whose function remains unknown.
cd10973	CE4_DAC_u4_5s	6.48e-24	92	252	1	156	Putative catalytic NodB homology domain of uncharacterized bacterial polysaccharide deacetylases which consist of a 5-stranded beta/alpha barrel. This family contains many uncharacterized bacterial polysaccharide deacetylases. Although their biological functions remain unknown, all members of the family are predicted to contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
COG0726	CDA1	1.07e-23	29	241	1	202	Peptidoglycan/xylan/chitin deacetylase, PgdA/CDA1 family [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFS79569.1	8.03e-31	29	249	31	258
ADU29695.1	1.18e-26	28	258	71	304
AEE91926.1	2.11e-26	25	223	43	243
CCP26752.1	2.11e-26	25	223	43	243
BCZ47871.1	3.49e-23	28	262	35	258

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WCJ_A	1.17e-10	29	223	37	228	Structureof IcaB from Ammonifex degensii [Ammonifex degensii KC4]
4U10_A	1.33e-10	28	171	3	150	Probingthe structure and mechanism of de-N-acetylase from aggregatibacter actinomycetemcomitans [Aggregatibacter actinomycetemcomitans],4U10_B Probing the structure and mechanism of de-N-acetylase from aggregatibacter actinomycetemcomitans [Aggregatibacter actinomycetemcomitans]
6DQ3_A	9.70e-08	28	222	8	193	ChainA, Polysaccharide deacetylase [Streptococcus pyogenes],6DQ3_B Chain B, Polysaccharide deacetylase [Streptococcus pyogenes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94361	6.62e-19	25	259	61	272	Putative polysaccharide deacetylase YxkH OS=Bacillus subtilis (strain 168) OX=224308 GN=yxkH PE=3 SV=1
P31666	2.16e-17	29	222	170	368	Uncharacterized protein YadE OS=Escherichia coli (strain K12) OX=83333 GN=yadE PE=3 SV=2
Q5HKP8	1.38e-13	24	251	39	272	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=icaB PE=3 SV=1
Q6TYB1	1.38e-13	24	251	39	272	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus epidermidis OX=1282 GN=icaB PE=1 SV=2
Q6G606	5.80e-12	24	250	40	272	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=icaB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.960814	0.037230	0.001520	0.000083	0.000059	0.000307

TMHMM  Annotations     

start	end
7	24