CAZyme Information: MGYG000000951_01144

Basic Information

• Species: GCA-900066495 sp900545985
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; GCA-900066495; GCA-900066495 sp900545985
• CAZyme ID: MGYG000000951_01144
• CAZy Family: GT2
• CAZyme Description: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
599	MGYG000000951_13|CGC1	70343.83	9.3095

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000951	3022567	MAG	China	Asia

• Gene Location: Start: 22442; End: 24241 Strand: +

Full Sequence      

MKEVFPKSKSDRRLLTHVPDPTNRRKTVDRRGINLDSSYEFGIRYELEIPVYIYTKEEMI
EAQSIDLSVTGILIKIKKDTNYSISEGDNVKLKFYIPEGYMKEGYDHKVKINSNIVRSFE
DEEYIYFGCVFEKNLHNYFTKRRWISEISIASIFLGLVSFSIIGMRINSVIYFRYDPLIY
GYSILTAVYLLSRYLFGAFYKSVPIDENYTPGVSVIIPCFNEEEWIQKTIIGCLNQDYPI
DKLEVIVVDDCSNDNSVQKINEIIERLKVECSDYDVESRIKFILQPDNRGKREALVAGVN
VAKHELVTFVDSDSFLEPRAIKNLVQPFRDPKVGGVTGRTDVENAWTNYITKMQAVRYYV
AFRMIKAAESIFDCVTCLSGPISCYRKDLVDKYKYDWLSQTFLGQPATFGDDRSMTNFIL
KHHRTVYQDSAICTTIVPSDFKVFLKQQMRWKRSWLRESIRAGGFMWKKEPFHAISFYAG
IIVPVLAPLIVIYNMIYVPIVYKTFPIVFISGILLMSFLMSFVYLLFRKSKIWIYGLWFC
LFYECILIWQMPIACLTFWKSTWGTRKTKEDIAHEKKQKKRKQDKRRRKNMKEEYARSK

Enzyme Prediction     

No EC number prediction in MGYG000000951_01144.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	214	393	3.1e-32	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06423	CESA_like	2.28e-52	215	412	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd06434	GT2_HAS	7.94e-50	213	454	2	231	Hyaluronan synthases catalyze polymerization of hyaluronan. Hyaluronan synthases (HASs) are bi-functional glycosyltransferases that catalyze polymerization of hyaluronan. HASs transfer both GlcUA and GlcNAc in beta-(1,3) and beta-(1,4) linkages, respectively to the hyaluronan chain using UDP-GlcNAc and UDP-GlcUA as substrates. HA is made as a free glycan, not attached to a protein or lipid. HASs do not need a primer for HA synthesis; they initiate HA biosynthesis de novo with only UDP-GlcNAc, UDP-GlcUA, and Mg2+. Hyaluronan (HA) is a linear heteropolysaccharide composed of (1-3)-linked beta-D-GlcUA-beta-D-GlcNAc disaccharide repeats. It can be found in vertebrates and a few microbes and is typically on the cell surface or in the extracellular space, but is also found inside mammalian cells. Hyaluronan has several physiochemical and biological functions such as space filling, lubrication, and providing a hydrated matrix through which cells can migrate.
cd06439	CESA_like_1	1.26e-46	181	466	4	250	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.
COG1215	BcsA	6.38e-46	160	539	2	373	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
PRK11204	PRK11204	3.79e-35	211	543	54	381	N-glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJA08186.1	0.0	1	599	1	599
ARC85988.1	9.37e-245	3	580	14	612
AZK46434.1	1.27e-231	1	578	9	607
AJQ26841.1	1.62e-231	2	573	9	595
QCX34690.1	2.30e-231	1	580	10	606

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SP7_A	5.10e-30	273	468	162	360	ChainA, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2]
7SP6_A	2.23e-29	273	468	162	360	ChainA, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SP8_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SP9_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SPA_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2]
6YV7_B	4.54e-17	206	438	37	249	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
6YV7_A	4.59e-17	206	438	38	250	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
5TZE_C	9.71e-10	214	323	4	103	Crystalstructure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZE_E Crystal structure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZI_C Crystal structure of S. aureus TarS 1-349 [Staphylococcus aureus],5TZJ_A Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZJ_C Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZK_C Crystal structure of S. aureus TarS 1-349 in complex with UDP [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P04341	2.76e-43	182	474	15	304	N-acetylglucosaminyltransferase OS=Rhizobium meliloti (strain 1021) OX=266834 GN=nodC PE=3 SV=1
P0C0H0	3.12e-42	182	460	36	307	Hyaluronan synthase OS=Streptococcus pyogenes OX=1314 GN=hasA PE=3 SV=1
Q8NKX1	3.12e-42	182	460	36	307	Hyaluronan synthase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) OX=186103 GN=hasA PE=3 SV=1
P0DB61	4.29e-42	182	460	36	307	Hyaluronan synthase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) OX=193567 GN=hasA PE=3 SV=1
Q5X9A9	4.29e-42	182	460	36	307	Hyaluronan synthase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) OX=286636 GN=hasA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
144	163
178	200
475	497
507	527
532	554