CAZyme Information: MGYG000000951_01146

Basic Information

• Species: GCA-900066495 sp900545985
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; GCA-900066495; GCA-900066495 sp900545985
• CAZyme ID: MGYG000000951_01146
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
331	MGYG000000951_13|CGC1	38532.37	4.2862

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000951	3022567	MAG	China	Asia

• Gene Location: Start: 25964; End: 26959 Strand: +

Full Sequence      

MKSKKIIYLGIALISILLISAIIKNMLIKEEKNNYKNDDISAWIVDWCIDDGIKEVNSLE
SNLNNIQVFGAYFNDKDEVFVSEDILNKDFNIQKDLYLTVVNDIIYENKKPVQKDTELIS
RILSDDEKRNNHINELIDLVNKYEFDGLELDYEKIDSNLWDEYILFIDDLGQLLSKNDKK
LRVVLEPSSPFDEFDMPSEYEYVVMAYNLYGYGTGPGPKADKSFIKTLSKKSVSNLENVR
IAFSLGGFDWNENEESPKALTKPDIDKIITDYDVNINRDEKSGANYFYYYDLDNVKHTVW
YSDEETIKTWMDTSKEEGVNKFALWRLGNSF

Enzyme Prediction     

No EC number prediction in MGYG000000951_01146.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	119	328	3.5e-22	0.7027027027027027

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06549	GH18_trifunctional	4.12e-34	98	328	63	291	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
cd02874	GH18_CFLE_spore_hydrolase	6.66e-33	88	331	55	306	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	6.87e-26	115	331	178	411	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
pfam00704	Glyco_hydro_18	2.58e-12	115	329	75	306	Glycosyl hydrolases family 18.
smart00636	Glyco_18	7.98e-07	120	325	83	329	Glyco_18 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJA08188.1	3.69e-232	1	331	1	331
ARC85986.1	3.31e-86	38	329	46	344
BBI33133.1	3.91e-79	29	328	42	349
AUS88138.1	5.74e-72	29	328	25	328
QGG52936.1	8.14e-72	29	328	29	332

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CZ8_A	5.81e-10	116	327	83	308	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
4Q6T_A	9.40e-06	115	328	84	325	Thecrystal structure of a class V chitininase from Pseudomonas fluorescens Pf-5 [Pseudomonas protegens Pf-5]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32258	1.56e-17	102	329	95	330	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1
O05495	4.41e-10	116	331	175	404	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.638998	0.356981	0.001965	0.000377	0.000314	0.001364

TMHMM  Annotations     

start	end
6	28