CAZyme Information: MGYG000000953_01188

Basic Information

• Species: Fusobacterium_A sp900549465
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium_A; Fusobacterium_A sp900549465
• CAZyme ID: MGYG000000953_01188
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
339		39764.91	9.5606

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000953	1995240	MAG	Spain	Europe

• Gene Location: Start: 1489; End: 2508 Strand: -

Full Sequence      

MKRILVIRYKKSIGDTIIGTALCESLKKKYPDSQVDYLVYENLTELFYNHRSIDNVLTLD
RKAGIKGWFETLKKIRKNKYDIVVDCRTIFVTAIFSFLSGAKQRIGKYHKYLQYFYTKSI
NGFKGKENRIDQIVKYHRLLKPLDINEVNTEYVICLKEEEKTEWRNRMEAEGIDMSKLII
PMAVNARQSNKKYPEEYMLKIAQTLIDRYDAQIILFYSPNEEAYAREFYAKLNSNRNVFI
NLKTKNVRELACIFSNCDLFVGNEGGTRHVAEGVGLANLCIVAPQTSKEEWISNENSKNQ
CVTIQDVNGKNYEDIKPEYVLKRIDKQLQLFNFFNKKHK

Enzyme Prediction     

No EC number prediction in MGYG000000953_01188.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	71	297	4.8e-33	0.8533333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	3.93e-47	1	329	1	331	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	1.23e-45	3	326	1	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK10422	PRK10422	6.73e-16	2	284	6	290	lipopolysaccharide core biosynthesis protein; Provisional
pfam01075	Glyco_transf_9	3.49e-13	73	310	6	245	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVQ18853.1	7.41e-201	1	339	1	336
ADO84502.1	4.41e-86	3	331	2	333
AVQ31324.1	3.30e-76	3	337	2	343
VEH39957.1	3.30e-76	3	337	2	343
VEH40966.1	1.54e-75	3	324	2	333

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	1.48e-12	5	322	11	339	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25742	1.43e-11	14	274	5	268	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2
Q9R9D5	3.39e-11	14	274	5	268	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000953_01188.