CAZyme Information: MGYG000000956_01865

Basic Information

• Species: Barnesiella sp900538705
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Barnesiellaceae; Barnesiella; Barnesiella sp900538705
• CAZyme ID: MGYG000000956_01865
• CAZy Family: PL10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372		43246.21	7.3428

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000956	2507716	MAG	Denmark	Europe

• Gene Location: Start: 58731; End: 59849 Strand: +

Full Sequence      

MKRTLLIIGCIALFTTLYGQEIPSLKYFRDGIKHWQMQHPEGSYPRWDETDFIHIADNIV
AYQNEDGGWMKNIDWLAKLNPDSVIASLSPKHRRSTIDNRNVIPQITYLADVYQRTGNEK
YRQAAERGIEYIINTQKENGGWRGWDADAITFNDDVTTNVMQFLCDVVQGDPLFKWLSRD
NINRIAAAYHKGIDVILRCQVVQNGVKTIWAQQHDNITYEPVKARSYELPGLSAPESSQI
LLMLMSIDNPSQEVKEAITCGVKWMWNNRIEGIKVEKIVIGTDSVTGKNIYDRVVVKDST
VRRPIWARYYNLENNKPFFCRRSGEKVWRLADVDYERRIGYGWYGRQPMEVLKEYPDWAE
RMGVPFTGFDNM

Enzyme Prediction     

No EC number prediction in MGYG000000956_01865.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL10	63	350	1.2e-94	0.9930555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam09492	Pec_lyase	1.34e-97	63	352	1	289	Pectic acid lyase. Members of this family are isozymes of pectate lyase (EC:4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase.
TIGR02474	pec_lyase	1.51e-94	63	352	1	290	pectate lyase, PelA/Pel-15E family. Members of this family are isozymes of pectate lyase (EC 4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
cd00688	ISOPREN_C2_like	0.001	106	200	34	117	This group contains class II terpene cyclases, protein prenyltransferases beta subunit, two broadly specific proteinase inhibitors alpha2-macroglobulin (alpha (2)-M) and pregnancy zone protein (PZP) and, the C3 C4 and C5 components of vertebrate complement. Class II terpene cyclases include squalene cyclase (SQCY) and 2,3-oxidosqualene cyclase (OSQCY), these integral membrane proteins catalyze a cationic cyclization cascade converting linear triterpenes to fused ring compounds. The protein prenyltransferases include protein farnesyltransferase (FTase) and geranylgeranyltransferase types I and II (GGTase-I and GGTase-II) which catalyze the carboxyl-terminal lipidation of Ras, Rab, and several other cellular signal transduction proteins, facilitating membrane associations and specific protein-protein interactions. Alpha (2)-M is a major carrier protein in serum and involved in the immobilization and entrapment of proteases. PZP is a pregnancy associated protein. Alpha (2)-M and PZP are known to bind to and, may modulate, the activity of placental protein-14 in T-cell growth and cytokine production thereby protecting the allogeneic fetus from attack by the maternal immune system.
pfam13243	SQHop_cyclase_C	0.001	115	164	83	149	Squalene-hopene cyclase C-terminal domain. Squalene-hopene cyclase, EC:5.4.99.17, catalyzes the cyclisation of squalene into hopene in bacteria. This reaction is part of a cationic cyclisation cascade, which is homologous to a key step in cholesterol biosynthesis. This family is the C-terminal half of the molecule.
cd02892	SQCY_1	0.003	121	200	398	489	Squalene cyclase (SQCY) domain subgroup 1; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold. Squalene cyclase (SQCY) and 2,3-oxidosqualene cyclase (OSQCY) are integral membrane proteins that catalyze a cationic cyclization cascade converting linear triterpenes to fused ring compounds. This group contains bacterial SQCY which catalyzes the convertion of squalene to hopene or diplopterol and eukaryotic OSQCY which transforms the 2,3-epoxide of squalene to compounds such as, lanosterol in mammals and fungi or, cycloartenol in plants. Deletion of a single glycine residue of Alicyclobacillus acidocaldarius SQCY alters its substrate specificity into that of eukaryotic OSQCY. Both enzymes have a second minor domain, which forms an alpha-alpha barrel that is inserted into the major domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY37157.1	2.26e-122	2	372	5	379
QDU41600.1	3.38e-106	24	367	50	395
QDT46035.1	3.85e-105	24	358	50	386
QDU80650.1	1.03e-103	24	364	47	389
QIH44490.1	3.56e-84	1	361	1	359

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1R76_A	6.19e-52	54	361	85	407	ChainA, pectate lyase [Niveispirillum irakense]
1GXM_A	5.65e-46	56	363	37	330	Family10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXM_B Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXN_A Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus]
1GXO_A	8.38e-45	56	363	37	330	MutantD189A of Family 10 polysaccharide lyase from Cellvibrio cellulosa in complex with trigalaturonic acid [Cellvibrio japonicus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000237	0.999124	0.000161	0.000156	0.000147	0.000138

TMHMM  Annotations     

start	end
5	22