CAZyme Information: MGYG000000959_00509

Basic Information

• Species: Ruminococcus sp900752785
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus; Ruminococcus sp900752785
• CAZyme ID: MGYG000000959_00509
• CAZy Family: CE12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1038	MGYG000000959_8|CGC1	113004.44	4.6298

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000959	2365658	MAG	Denmark	Europe

• Gene Location: Start: 12370; End: 15486 Strand: -

Full Sequence      

MNIKKIVSGLTSLALSLTSFGGIRTFNKTESLSAKAAAANWKFDFGAGGVADGFTGVSAA
EGYNSSKGYGFAQTNNMANVSASGKNELSDAVQFKSTDAGNTFNVDLPKGLYQVTVHLGD
TNRTSVRAEGMLQLMNLTGNNASDTFQIPVTDGQLNIQACEGKAGYAFTMSSLEIKQLNT
TGETNPTVWLCGDSTVANYYNVADTAQHGWGMYIGDYIDDTYWQVRNMAASGQYAKGFMD
AGQFDAIETYGKTGDIYIISIGINDTNYSNAEEYHNTVTDMVKRAKAKGMTVYLVKQQGR
RGDLTRNPLLKGRWFGGELDKVGSEQNVEVVDLFTPWQDFGISVGYDGMASYYAIQANGS
ADDLHQSALGSKKLAEIMSGLINFTGREAALMDESVSYMFKNVNSGLYMEVSDAKAEAGA
NVQQWGAEGAAAHNTWKLKAADNGYYYIYSNLGDGKTYLLDLDAGKTANGTNIGIYTNTN
STAQHFKFYENNDGSYTIVTRTTGGKSAVEVKSALTSNGGNIQQWELNGHNCQKWNAEKV
EYPIITTTTTTTTTTTTTVETTVTAAEPVLKKFPGDTNVDDEVNLADAVLIMQNLANPNK
YFIEKQGLINADVVDNDGVTPNDALFIQKYCLGLEKLPEKEYEIPKTTTSTVTTTTATTT
TTSHYYFAVDQTWDKGVTETVNEGFTRNDGYVNLDNVIDSSITWTVNAPKSGNYLTTFRV
ANGTDSDREMKIVVNENNDSFWIQSFTGTGAWTLWEERGIVLPLNGGKNTIKLISRTAGG
GPNFDYLTIDLTDEPIAEIYDPSNDPFQNETEKPVIYIAGDSTVQSYRASYAPQQGWGYY
LGNYFNDNVTVANHAIAGRSSKSFYDQGRFQTITDNLKKGDFVLIQFAINDSAASIAERY
APVCGNVDNPASGSYEWYLTQFIKDTQAKGATPILVTTVIGMKAYSGGKFVGSYTNYCDA
CKKLAAKYNIPCIDLNTLMVNHYNSIGYDAAVKYHLMGVVDGSTDGTHFCETGANVVAGL
TANAIKEQKIFGLFEYVK

Enzyme Prediction     

EC	3.1.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE12	816	1025	4.7e-63	0.9904761904761905
CE12	187	378	1.6e-35	0.9761904761904762
CBM13	397	559	4.9e-25	0.7925531914893617
CBM35	672	789	1.3e-17	0.9411764705882353

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01821	Rhamnogalacturan_acetylesterase_like	5.80e-65	814	1025	1	198	Rhamnogalacturan_acetylesterase_like subgroup of SGNH-hydrolases. Rhamnogalacturan acetylesterase removes acetyl esters from rhamnogalacturonan substrates, and renders them susceptible to degradation by rhamnogalacturonases. Rhamnogalacturonans are highly branched regions in pectic polysaccharides, consisting of repeating -(1,2)-L-Rha-(1,4)-D-GalUA disaccharide units, with many rhamnose residues substituted by neutral oligosaccharides such as arabinans, galactans and arabinogalactans. Extracellular enzymes participating in the degradation of plant cell wall polymers, such as Rhamnogalacturonan acetylesterase, would typically be found in saprophytic and plant pathogenic fungi and bacteria.
cd04082	CBM35_pectate_lyase-like	5.91e-48	665	789	2	124	Carbohydrate Binding Module family 35 (CBM35), pectate lyase-like; appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. This family includes carbohydrate binding module family 35 (CBM35) domains that are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. Included in this family are CBM35s of pectate lyases, including pectate lyase 10A from Cellvibrio japonicas, these enzymes release delta-4,5-anhydrogalaturonic acid (delta4,5-GalA) from pectin, thus identifying a signature molecule for plant cell wall degradation. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. Some CBM35s bind their ligands in a calcium-dependent manner, especially those binding uronic acids.
cd01821	Rhamnogalacturan_acetylesterase_like	6.98e-30	186	382	1	198	Rhamnogalacturan_acetylesterase_like subgroup of SGNH-hydrolases. Rhamnogalacturan acetylesterase removes acetyl esters from rhamnogalacturonan substrates, and renders them susceptible to degradation by rhamnogalacturonases. Rhamnogalacturonans are highly branched regions in pectic polysaccharides, consisting of repeating -(1,2)-L-Rha-(1,4)-D-GalUA disaccharide units, with many rhamnose residues substituted by neutral oligosaccharides such as arabinans, galactans and arabinogalactans. Extracellular enzymes participating in the degradation of plant cell wall polymers, such as Rhamnogalacturonan acetylesterase, would typically be found in saprophytic and plant pathogenic fungi and bacteria.
pfam14200	RicinB_lectin_2	2.03e-15	436	525	5	89	Ricin-type beta-trefoil lectin domain-like.
pfam14200	RicinB_lectin_2	2.49e-15	398	476	15	89	Ricin-type beta-trefoil lectin domain-like.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADU21040.1	0.0	1	1038	1	1020
CBL17979.1	0.0	3	1038	5	996
AEV69827.1	1.19e-152	2	1038	4	843
ABN54336.1	2.35e-152	23	1038	17	829
ANV75445.1	2.52e-151	23	1038	17	829

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2O14_A	3.06e-79	20	377	2	354	X-RayCrystal Structure of Protein YXIM_BACsu from Bacillus subtilis. Northeast Structural Genomics Consortium Target SR595 [Bacillus subtilis]
2W47_A	6.21e-25	666	789	7	128	ChainA, Lipolytic Enzyme, G-d-s-l [Acetivibrio thermocellus]
2W1W_A	6.57e-25	666	789	7	128	ChainA, LIPOLYTIC ENZYME, G-D-S-L [Acetivibrio thermocellus],2W1W_B Chain B, LIPOLYTIC ENZYME, G-D-S-L [Acetivibrio thermocellus]
2VZP_A	1.45e-20	666	789	6	127	AtomicResolution Structure of the C-terminal CBM35 from Amycolatopsis orientalis exo-chitosanase CsxA [Amycolatopsis orientalis],2VZP_B Atomic Resolution Structure of the C-terminal CBM35 from Amycolatopsis orientalis exo-chitosanase CsxA [Amycolatopsis orientalis],2VZQ_A C-terminal CBM35 from Amycolatopsis orientalis exo-chitosanase CsxA in complex with digalacturonic acid [Amycolatopsis orientalis],2VZQ_B C-terminal CBM35 from Amycolatopsis orientalis exo-chitosanase CsxA in complex with digalacturonic acid [Amycolatopsis orientalis],2VZR_A C-terminal CBM35 from Amycolatopsis orientalis exo-chitosanase CsxA in complex with glucuronic acid [Amycolatopsis orientalis],2VZR_B C-terminal CBM35 from Amycolatopsis orientalis exo-chitosanase CsxA in complex with glucuronic acid [Amycolatopsis orientalis]
5M2O_B	2.48e-19	570	641	24	96	R.flavefaciens' third ScaB cohesin in complex with a group 1 dockerin [Ruminococcus flavefaciens FD-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42304	1.19e-82	20	377	17	369	Uncharacterized esterase YxiM OS=Bacillus subtilis (strain 168) OX=224308 GN=yxiM PE=1 SV=2
O31528	4.86e-36	816	1027	5	204	Probable rhamnogalacturonan acetylesterase YesY OS=Bacillus subtilis (strain 168) OX=224308 GN=yesY PE=1 SV=1
O31523	1.41e-29	812	1027	3	214	Rhamnogalacturonan acetylesterase RhgT OS=Bacillus subtilis (strain 168) OX=224308 GN=rhgT PE=1 SV=1
Q56F26	8.09e-17	666	789	911	1032	Exo-beta-D-glucosaminidase OS=Amycolatopsis orientalis OX=31958 GN=csxA PE=1 SV=2
Q00017	9.47e-16	816	1025	20	229	Rhamnogalacturonan acetylesterase OS=Aspergillus aculeatus OX=5053 GN=rha1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003246	0.554434	0.441589	0.000261	0.000247	0.000207

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000959_00509.