CAZyme Information: MGYG000000959_01143

Basic Information

• Species: Ruminococcus sp900752785
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus; Ruminococcus sp900752785
• CAZyme ID: MGYG000000959_01143
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378	MGYG000000959_25|CGC1	42436.4	4.6969

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000959	2365658	MAG	Denmark	Europe

• Gene Location: Start: 3579; End: 4715 Strand: +

Full Sequence      

MKKRMLTLVLLVCTIIHIAPFRVESASVIRLVGYLPDWAYSVYKNIDFEALTHLNIAFCN
PDKNGNISCSIPDMELENIICKAHENNVKAMAALGGAGGCDGYLPLINNSNRMNDFNKKI
MDYCEKYDFDGIDLDLELNSGHEIWNYYGDWVNSLRNLCDERGFELSTASARWLGVKVSA
DTFSKFDFINVMAYDNDLSKISHADMSYALELLDYFHKQKNISKDKLVLGVPFYGRGYNA
DGSLDWNSYMPFSKIIASDPQNFYSDNYNGIAYNGASLISEKCALSKEYGGIMIWELTQD
AAGEYSLLKLIKEKLALRRLIGDVNDDGELSAADLVMLSKWLHGCGELVNAQLADINGDN
AINIYDLVFLRGILINKV

Enzyme Prediction     

No EC number prediction in MGYG000000959_01143.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	29	305	4.3e-42	0.9527027027027027

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06545	GH18_3CO4_chitinase	1.18e-56	32	311	2	253	The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas.
pfam00704	Glyco_hydro_18	2.35e-28	30	300	1	307	Glycosyl hydrolases family 18.
smart00636	Glyco_18	4.31e-24	30	300	1	334	Glyco_18 domain.
cd06548	GH18_chitinase	3.57e-18	32	300	2	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
cd02872	GH18_chitolectin_chitotriosidase	2.07e-13	103	315	87	362	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATL49267.1	5.80e-50	24	315	39	328
APR88556.1	2.09e-45	30	311	191	478
QRK06205.1	6.14e-43	30	315	214	506
AFE08340.1	6.61e-43	22	311	39	321
ADO75397.1	6.91e-43	30	311	201	489

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6XYZ_A	3.92e-39	20	314	9	304	Crystalstructure of the GH18 chitinase ChiB from the chitin utilization locus of Flavobacterium johnsoniae [Flavobacterium johnsoniae UW101]
3CO4_A	5.75e-27	31	311	6	295	Crystalstructure of a chitinase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],3FND_A Crystal structure of a chitinase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron]
5XWQ_A	3.03e-13	30	236	3	237	Crystalstructure of chitinase (RmChi1) from Rhizomucor miehei (sp p32 2 1, MR) [Rhizomucor miehei],5YUQ_A Chain A, Chintase [Rhizomucor miehei],5YUQ_B Chain B, Chintase [Rhizomucor miehei],7FBT_A Chain A, Chitinase [Rhizomucor miehei]
5XWF_A	1.75e-12	30	236	3	237	ChainA, Fungal chitinase from Rhizomucor miehei (SeMet-substituted proteins) [Rhizomucor miehei]
1ITX_A	2.73e-12	20	300	3	406	ChainA, Glycosyl Hydrolase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P36362	6.21e-12	23	238	17	274	Endochitinase OS=Manduca sexta OX=7130 PE=2 SV=1
P20533	2.25e-11	20	300	35	438	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
Q9W092	2.32e-10	34	300	53	389	Probable chitinase 2 OS=Drosophila melanogaster OX=7227 GN=Cht2 PE=1 SV=1
Q13231	1.16e-06	27	317	20	387	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
Q9D7Q1	2.05e-06	23	317	16	385	Chitotriosidase-1 OS=Mus musculus OX=10090 GN=Chit1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000262	0.999151	0.000142	0.000163	0.000140	0.000138

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000959_01143.