CAZyme Information: MGYG000000959_01910

Basic Information

• Species: Ruminococcus sp900752785
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus; Ruminococcus sp900752785
• CAZyme ID: MGYG000000959_01910
• CAZy Family: CBM35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1000		108480.46	4.348

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000959	2365658	MAG	Denmark	Europe

• Gene Location: Start: 2271; End: 5273 Strand: +

Full Sequence      

MNSKFMKGTVTALCAALTAASVPNAAPVSANAAEDFNYYIRGDVIGNDGVTSDDAFTIQS
YVLGLKQFSDEQLIPADSNADGDVNLADAVNIMQWLIKLEKRYRVGEYIHKDTLAGDTVE
FSAGQQGAANFNFTADFSGNYKLRINYSNSEDPADFQIIANNGSVYTPAVFETTEGWKEA
VYIIKLNEGKNAIEIAPESPSAKVSIKNIEILRTENIPDATLKRPVTTTTTTTTTTTASE
TTTSTTTTETPPIPVAERYYAIDAEFYDSWKEDINAGFAGEAYVNYNNAVGSYVNWTVDV
PEDGNYLVTFRYANGTEANRTVKVTVNGSKECCYMDFSGTGSWTQWDDSSVVLALKAGKN
TVKATATTSGGGPNMDYIEVIETDKPAAEMVMPKDGKRVEKLNRGVSAAYTGSGVLVSWR
ILGTDSENTTFKLFKNGKQPPIYEGTINDASCFLDKNGTAADWYTIDTYVDGECTEFAQA
SINLTNKNSGQSGAYFDIPLNTPPGGTTPTGEAYTYTANDCSVGDIDGDGQYEIFVKWDP
SNSKDNANAGYTGNVYIDCYTLDGKQLWRVDLGKNIRAGAHYTQFMVYDFDGDNKAEMIC
KTADGTVDGTGMVIGDGSKDYRMTGKVDGKRGDPTGKPLSGPEYLTLFDGATGKAIDTID
YKPGRGDADAWGDQYGNRSERMTACVAYLNGTTPSAVFGRGYYTRSALTAYNVVNGKLVE
YWSYDTGHNSSVAGYGDGNHHILAADVDGDGKQEVVVGSAVVDDNGKLLYTSGLGHGDAI
HVGDFDPSNPGVEIFQCHEEEEAGFGISLRDGKTGKILFRETAGGDTGRCIADNLIAGNA
GAEMVGSHNSVIYAAFGSHEKVGAWSDITKWGMNSVVYWTDVLERAVLDRTMVDQHGKGR
VFTGDGVDYNNYTKSNACLTADLFGDWREEMIFRKSDGTGLRVFATTFETQYPIYTLMHN
PQYRVQVASENNGYNQPPHTDYFLGTGYDLPKVPEVYSED

Enzyme Prediction     

No EC number prediction in MGYG000000959_01910.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL11	398	997	1.6e-228	0.9948542024013722
CBM35	260	380	2e-25	0.9831932773109243

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10318	RGL11	0.0	399	982	1	564	Rhamnogalacturonan lyase of the polysaccharide lyase family 11. The rhamnogalacturonan lyase of the polysaccharide lyase family 11 (RGL11) cleaves glycoside bonds in polygalacturonan as well as RG (rhamnogalacturonan) type-I through a beta-elimination reaction. Functionally characterized members of this family, YesW and YesX from Bacillus subtilis, cleave glycoside bonds between rhamnose and galacturonic acid residues in the RG-I region of plant cell wall pectin. YesW and YesX work synergistically, with YesW cleaving the glycoside bond of the RG chain endolytically, and YesX converting the resultant oligosaccharides through an exotype reaction. This domain is sometimes found in architectures with non-catalytic carbohydrate-binding modules (CBMs). There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain through a beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
cd04082	CBM35_pectate_lyase-like	4.01e-50	258	380	2	124	Carbohydrate Binding Module family 35 (CBM35), pectate lyase-like; appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. This family includes carbohydrate binding module family 35 (CBM35) domains that are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. Included in this family are CBM35s of pectate lyases, including pectate lyase 10A from Cellvibrio japonicas, these enzymes release delta-4,5-anhydrogalaturonic acid (delta4,5-GalA) from pectin, thus identifying a signature molecule for plant cell wall degradation. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. Some CBM35s bind their ligands in a calcium-dependent manner, especially those binding uronic acids.
pfam18370	RGI_lyase	2.07e-23	397	473	1	75	Rhamnogalacturonan I lyases beta-sheet domain. This is the beta-sheet domain found in rhamnogalacturonan (RG) lyases, which are responsible for an initial cleavage of the RG type I (RG-I) region of plant cell wall pectin. Polysaccharide lyase family 11 carrying this domain, such as YesW (EC:4.2.2.23) and YesX (EC:4.2.2.24), cleave glycoside bonds between rhamnose and galacturonic acid residues in RG-I through a beta-elimination reaction. Other family members carrying this domain are hemagglutinin A, lysine gingipain (Kgp) and Chitinase C (EC:3.2.1.14).
cd04083	CBM35_Lmo2446-like	7.70e-23	275	380	20	125	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
cd02795	CBM6-CBM35-CBM36_like	1.50e-14	258	380	1	124	Carbohydrate Binding Module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules. This alignment model also contains the C-terminal domains of bacterial insecticidal toxins, where they may be involved in determining insect specificity through carbohydrate binding functionality.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL17717.1	0.0	259	998	120	848
ABN51485.1	3.05e-232	258	997	110	817
ADU75030.1	6.08e-232	258	997	110	817
ALX08998.1	6.08e-232	258	997	110	817
ANV76748.1	6.08e-232	258	997	110	817

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Z8R_A	1.06e-188	397	998	3	582	Crystalstructure of rhamnogalacturonan lyase YesW at 1.40 A resolution [Bacillus subtilis],2Z8R_B Crystal structure of rhamnogalacturonan lyase YesW at 1.40 A resolution [Bacillus subtilis],2Z8S_A Crystal structure of rhamnogalacturonan lyase YesW complexed with digalacturonic acid [Bacillus subtilis],2Z8S_B Crystal structure of rhamnogalacturonan lyase YesW complexed with digalacturonic acid [Bacillus subtilis],2ZUX_A Crystal structure of rhamnogalacturonan lyase YesW complexed with rhamnose [Bacillus subtilis],2ZUX_B Crystal structure of rhamnogalacturonan lyase YesW complexed with rhamnose [Bacillus subtilis]
4CAG_A	2.80e-187	397	998	9	589	Bacilluslicheniformis Rhamnogalacturonan Lyase PL11 [Bacillus licheniformis]
2ZUY_A	2.18e-184	397	997	6	602	Crystalstructure of exotype rhamnogalacturonan lyase YesX [Bacillus subtilis]
2W47_A	4.56e-37	259	384	7	132	ChainA, Lipolytic Enzyme, G-d-s-l [Acetivibrio thermocellus]
2W1W_A	4.85e-37	259	384	7	132	ChainA, LIPOLYTIC ENZYME, G-D-S-L [Acetivibrio thermocellus],2W1W_B Chain B, LIPOLYTIC ENZYME, G-D-S-L [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31526	1.54e-187	397	998	40	619	Rhamnogalacturonan endolyase YesW OS=Bacillus subtilis (strain 168) OX=224308 GN=yesW PE=1 SV=1
O31527	9.14e-184	397	997	6	602	Rhamnogalacturonan exolyase YesX OS=Bacillus subtilis (strain 168) OX=224308 GN=yesX PE=1 SV=1
Q56F26	3.90e-23	259	378	911	1030	Exo-beta-D-glucosaminidase OS=Amycolatopsis orientalis OX=31958 GN=csxA PE=1 SV=2
P23030	5.40e-16	268	381	175	289	Endo-1,4-beta-xylanase B OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=xynB PE=1 SV=2
P23031	5.67e-16	268	381	175	289	Alpha-L-arabinofuranosidase C OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=xynC PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002998	0.993206	0.001459	0.000841	0.000701	0.000769

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000959_01910.