CAZyme Information: MGYG000000963_00333

Basic Information

• Species: CAG-617 sp900553285
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; CAG-617; CAG-617 sp900553285
• CAZyme ID: MGYG000000963_00333
• CAZy Family: GH84
• CAZyme Description: O-GlcNAcase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
738		82528.13	6.6379

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000963	1599597	MAG	Denmark	Europe

• Gene Location: Start: 19558; End: 21774 Strand: +

Full Sequence      

MKKCLLWLAALCLSCNFGEMRAQVNPTPQQMEIKADKPLALPSKYGISLPANRQGTAAAK
LLAKLFPASSSDADFEIIAGVKGDKNIRKWAKKIPLHAEGYYLNSEGKQIVVAGADERGL
FYGLETLRQLMTDSTVLSVEITDYPDVPYRGIVEAFYGTPWPHAARLRQMDFYGENKLNV
YLYGPKDDPYHSVPNWRKPYPEKEAAQIKELVGRAKENGVIFYWAIHPGGDIKWNTTDRD
LLMAKFESMYQLGVRAFAVFFDDIAGEGAKADKQVELLNYIDNQFVAKKGDVAPLVMCPT
EYNKAWANPASGYLRTLGAKLNKDIEIMWTGNSVVHCIDKPSMEWINGQIGRKAYVWWNY
PVSDYCRNHMLLGPVYGNGLDIKDDVSAFVSNPMEHAEASKVALYSIADYVWNMEAFDSL
QSWRRALKAILPECADEFYVFASHSSDLGPNGHGFRRAESVDLQPYLKAWEASKGSDERA
SMAVAAGCDRLAAAADVLLADKENVPLVKEMEPWLRQARLIGDYGQAVVGMTVCLMNGNS
TDFMPLYRHAHALQQLMYENNEVYNQNPYQPGVEVGSLVLLPTINKMYTYAAQEYNRREQ
ADLDTLATYQPYSLESTVPQLKQQPVSGRGNGVAVSPSNEVVMWPAGASLTVKMDKVRTL
TGLSFDLGTPGISRDFTLEASADGEKWMRIDLIQQDGKTVVHTTDVINGMKADRVRLTNS
SGKELKVYLRSFKFTKRN

Enzyme Prediction     

No EC number prediction in MGYG000000963_00333.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	150	442	4.6e-106	0.9932203389830508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	1.50e-166	150	441	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam18344	CBM32	2.50e-25	603	666	1	64	Carbohydrate binding module family 32. This domain is found in GH84C present in Clostridium perfringens. GH84C is a beta-N-acetylglucosaminidase. This domain is a family 32 carbohydrate binding module (CBM) which preferentially recognizes the non-reducing terminus of N-acetyllactosamine.
pfam02838	Glyco_hydro_20b	9.14e-17	26	143	6	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.
COG3525	Chb	3.36e-05	84	181	192	295	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO23617.1	5.93e-303	16	737	15	739
AVM57269.1	7.58e-268	1	737	1	735
AVM51628.1	2.85e-265	20	737	19	735
QUU04653.1	4.00e-261	9	735	11	736
QRP88417.1	4.00e-261	9	735	11	736

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VVN_A	4.24e-246	1	735	1	733	BtGH84in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVN_B BtGH84 in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVS_A BtGH84 structure in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],2X0H_A BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],2X0H_B BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],4AIS_A A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],4AIS_B A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],7OU8_AAA Chain AAA, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482],7OU8_BBB Chain BBB, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482]
7K41_A	6.51e-246	18	735	2	715	ChainA, O-GlcNAcase BT_4395 [Escherichia coli K-12]
2JIW_A	1.18e-245	20	735	1	712	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482],2JIW_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482]
2WZH_A	2.42e-245	1	735	1	733	BtGH84D242N in complex with MeUMB-derived oxazoline [Bacteroides thetaiotaomicron VPI-5482],4AIU_A A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482]
2WZI_A	2.42e-245	1	735	1	733	BtGH84D243N in complex with 5F-oxazoline [Bacteroides thetaiotaomicron VPI-5482],2WZI_B BtGH84 D243N in complex with 5F-oxazoline [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q89ZI2	2.32e-245	1	735	1	733	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q8XL08	1.57e-92	96	446	128	483	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
Q0TR53	4.18e-92	96	446	128	483	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
P26831	3.01e-45	92	724	118	783	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
O60502	3.63e-36	151	469	63	420	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000623	0.683819	0.314786	0.000280	0.000261	0.000219

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000963_00333.