CAZyme Information: MGYG000000963_00550

Basic Information

• Species: CAG-617 sp900553285
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; CAG-617; CAG-617 sp900553285
• CAZyme ID: MGYG000000963_00550
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
305	MGYG000000963_25|CGC1	35333.45	10.1403

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000963	1599597	MAG	Denmark	Europe

• Gene Location: Start: 1616; End: 2533 Strand: +

Full Sequence      

MRREVYLRLFTFLGLLMCISWFRVAAQRSAYDVYIDTYKALAVEQMNRYGIPASITLAQG
LLESSAGKSELSRKANNHFGIKCGSGWTGPYVLRDDDARGEKFRAYNSPRESYEDHSVFL
TSKSRYAFLFKYKKTDYKSWAHGLKKAGYATNPHYAHLLIKLIRRYELDKFDRMGMSDFP
AYPPAMGKMTVELIVRRNNDNYYVVARSGDTYASIGREMGVSERKLRKYNEVDKHYRLQA
GDIVYLEKKRSKADRSFKNKYHTVQAGESLYTIAQKYGIKLKTIYETNGLDADHVARVGE
RLKIR

Enzyme Prediction     

No EC number prediction in MGYG000000963_00550.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	41	168	2.1e-35	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	1.06e-35	24	173	36	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	1.23e-33	34	172	163	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
396413	pfam01832	1.33e-26	39	116	1	77	Glucosaminidase Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
smart00047	LYZ2	6.71e-24	33	172	10	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK12709	flgJ	4.27e-23	32	165	174	318	flagellar rod assembly protein/muramidase FlgJ; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR67483.1	8.15e-102	10	305	8	298
QJR58959.1	8.15e-102	10	305	8	298
QJR63222.1	8.15e-102	10	305	8	298
QJR71820.1	8.15e-102	10	305	8	298
ALA74116.1	8.15e-102	10	305	8	298

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	1.61e-16	32	163	2	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	1.96e-16	32	163	3	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	1.37e-15	32	163	3	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
5T1Q_A	2.28e-10	51	182	80	222	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
3FI7_A	1.41e-07	32	172	31	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	9.50e-18	32	177	49	203	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
P58231	2.80e-11	50	165	168	293	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1
P75942	2.80e-11	50	165	168	293	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1
Q2G222	3.23e-10	51	182	340	482	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1
Q9X9J3	5.44e-10	32	167	161	306	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.066940	0.432048	0.496809	0.001584	0.001073	0.001524

TMHMM  Annotations     

start	end
5	27