CAZyme Information: MGYG000000963_00910

Basic Information

• Species: CAG-617 sp900553285
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; CAG-617; CAG-617 sp900553285
• CAZyme ID: MGYG000000963_00910
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1105		122749	4.579

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000963	1599597	MAG	Denmark	Europe

• Gene Location: Start: 3988; End: 7305 Strand: +

Full Sequence      

MNIKKHILWAALALPLTAAAQEITFETTDYKAVGTYDSWEESPFRTGQLKGNVAVVSNHL
NQVDEDLEMSPNATGHILGFQRSRYGSNLYGARIDLNTTFELTKTTKYVHVLIHKPTEGR
VMLIGLGKRHERAGQSPETEQFWALSSQTVTPGAWCDAVFPIKGAGGIDIYSLVVVPDCE
SPHNLKDDYAVYIDEIEVNDDSTPRFRRGDYVINYDEGTTVSRTDRNLTGVSLNGSKDGN
QSLEWTLPSPKPLYLTQLDKSFTAKAGETLMPGFKYNNNWMNGFVYLDRGNDGKFSHELN
EDYTIPEGSDIMSYSYVETVTNTEGYLSDGTRVTGGARNVLNPPQFTVPSDLPNGYYRLR
FKLDWGNVDPGGSPTIVSDGGIIVDTRLNIHGDVCHVTNAQRNGDVLTEDGGTLNNYEAP
FGEPLTVKMDPEKGFTYEGIRVRYGYNLSGDSLVHGTPQYVDVVYPAYLFRDNKFTIPAE
IMTADVQIEGLFVEISGNTPEEGEDYALNFDKSLTITRTDRKLNSFTLQGTQGGESTLTL
DTEGDNTVYRDMTDVEVSLVPGDVVNTTVDYTGRAMHNYLYIDLNQDGQFSNSLNADGTP
TPSGELVSYTYFDGKNSLGETISGQAGSVSVGSSPAFTLPASLPAGVYRARFKVDWNNID
PAGQWEEGAGNQINKNGGYIIDFLLNVHQPTQTLEVQTENGSVNGENYTGLPLKLPLFTE
LTVVPTPAAKGFVAENMVIQHGYNFDGPQYIHGNKQWGKFSVPAETYTIPADSVNGDLLI
TVNYKRGETAEYTLVFNDEFNGEDGTQPDADKWVRCQRQSSTWNRWLSDSTAVIYIEDGK
LVARAIPNLDRSKDPVAMITGGIQSSGKYDFLYGKIEARILTNPHSGNFPAFWMMPTNQA
DGWPDCGEIDIWEQIDSENKAYHTVHSNWTYDLKHTNDPASSGNENVSMDRYHTYGLEWD
ANSMRWYVDGKQVFTYKKSSNANALNNGQWPFDKAFYIILNQSVGNGSWAANADTTHVYE
TRFDWVRVYQKNNETVGIINLNNEEPQFHVSASKGFIHVSCDIPTPITIHDTAGRLFFNE
TVNSEKSIPAMKGLYIVGHKKVIVP

Enzyme Prediction     

No EC number prediction in MGYG000000963_00910.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	797	1029	4.3e-54	0.991304347826087

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	1.45e-64	796	1029	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd00413	Glyco_hydrolase_16	2.63e-30	798	1029	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd02182	GH16_Strep_laminarinase_like	3.63e-26	792	1030	2	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
COG2273	BglS	2.75e-23	783	1037	40	273	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
cd02178	GH16_beta_agarase	1.33e-20	796	1030	25	258	Beta-agarase, member of glycosyl hydrolase family 16. Beta-agarase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of agarose, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Agarose is a linear chain of galactose units linked by alternating L-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Agarose forms thermo-reversible gels that are widely used in the food industry or as a laboratory medium. While beta-agarases are also found in two other families derived from the sequence-based classification of glycosyl hydrolases (GH50, and GH86) the GH16 members are most abundant. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ12302.1	5.79e-196	1	801	5	797
QFQ13169.1	1.44e-122	504	1031	23	542
BBA29449.1	4.04e-83	790	1031	46	281
QUB75565.1	5.58e-83	791	1054	47	300
QKH89566.1	3.91e-82	790	1031	46	281

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2R_AAA	4.68e-34	789	1030	26	262	ChainAAA, Beta-glycosidase [Bacteroides caccae]
4CRQ_A	3.86e-30	791	1031	2	232	Crystalstructure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CRQ_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CTE_A Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans],4CTE_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans]
6JH5_A	5.81e-29	792	1031	4	233	Structureof Marine bacterial laminarinase [Aquimarina]
6JHJ_A	3.65e-28	792	1031	4	233	Structureof Marine bacterial laminarinase mutant-E135A [Aquimarina],6JIA_A Marine bacterial laminarinase mutant E135A complex with laminaritetraose [Aquimarina sp.],6M6P_A Structure of Marine bacterial laminarinase mutant E135A in complex with 1,3-beta-cellotriosyl-glucose [Aquimarina sp.]
3ATG_A	1.41e-24	794	1029	5	238	endo-1,3-beta-glucanasefrom Cellulosimicrobium cellulans [Cellulosimicrobium cellulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZG90	8.47e-40	789	1030	53	288	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1
P23903	3.91e-21	790	1031	421	681	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
C1IE32	3.54e-18	792	1005	20	237	Glucan endo-1,3-beta-glucosidase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
P04957	1.99e-06	873	1031	100	242	Beta-glucanase OS=Bacillus subtilis (strain 168) OX=224308 GN=bglS PE=1 SV=2
Q75A41	7.50e-06	860	980	185	295	Probable glycosidase CRR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=CRR1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000301	0.998999	0.000207	0.000167	0.000156	0.000147

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000963_00910.