CAZyme Information: MGYG000000963_01090

Basic Information

• Species: CAG-617 sp900553285
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; CAG-617; CAG-617 sp900553285
• CAZyme ID: MGYG000000963_01090
• CAZy Family: GT4
• CAZyme Description: Glycosyltransferase Gtf1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376		43662.6	8.3565

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000963	1599597	MAG	Denmark	Europe

• Gene Location: Start: 2819; End: 3949 Strand: +

Full Sequence      

MKIVYCIRSLHNSGGMERVLTTKANYLADHMGYEVYIITRTNEGEPFFTLSPRIKVYNLQ
AKTLKEFRKRLTATLFNIRPAISISLYGAESHFLYKINDGSKKIIEFHFSKYYLTHLVNG
IRTLKFRTLHRIKAWWLQKREEQLARQYDKVILLTRQDLMLWGQKNNMCYIPNPLSFRST
HVSALESKRIIAVGRFIAQKGFDLLIDAFALIHKQYPDWSLDIYGEGQDHELLNHKITSY
SMQSQVRLLPPEKDIRQEFLNSSLLLFPSRYEGFGLVLTEAMECGLPCIAFDCECGPSEI
IEDGITGYLVPVGDVKGLSEKMEQLITHPTLLHEMGENARKAVKRFYPENIMHSWELLFE
ELMDCPHSQTQTRPLS

Enzyme Prediction     

No EC number prediction in MGYG000000963_01090.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	186	336	5.4e-41	0.94375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03820	GT4_AmsD-like	5.79e-130	2	356	1	350	amylovoran biosynthesis glycosyltransferase AmsD and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. AmSD in Erwinia amylovora has been shown to be involved in the biosynthesis of amylovoran, the acidic exopolysaccharide acting as a virulence factor. This enzyme may be responsible for the formation of galactose alpha-1,6 linkages in amylovoran.
cd03811	GT4_GT28_WabH-like	6.03e-59	2	332	1	332	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
cd03801	GT4_PimA-like	7.72e-55	8	364	8	363	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	3.30e-46	1	363	1	378	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03808	GT4_CapM-like	3.86e-46	2	352	1	353	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF13526.1	2.59e-125	1	363	1	362
QXP70136.1	2.14e-124	1	361	1	375
QXP62213.1	1.22e-123	1	361	1	375
AUC23103.1	9.91e-123	1	361	1	375
QXP67968.1	2.43e-118	1	361	1	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7EC2_A	6.18e-25	182	356	313	487	ChainA, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC2_B Chain B, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300]
4X7M_A	1.04e-19	145	359	273	491	ChainA, TarM [Staphylococcus aureus subsp. aureus 21178],4X7M_B Chain B, TarM [Staphylococcus aureus subsp. aureus 21178],4X7R_A Chain A, TarM [Staphylococcus aureus subsp. aureus 21178],4X7R_B Chain B, TarM [Staphylococcus aureus subsp. aureus 21178]
4X6L_A	1.04e-19	145	359	273	491	ChainA, TarM [Staphylococcus aureus subsp. aureus 21178],4X6L_B Chain B, TarM [Staphylococcus aureus subsp. aureus 21178],4X6L_C Chain C, TarM [Staphylococcus aureus subsp. aureus 21178],4X6L_D Chain D, TarM [Staphylococcus aureus subsp. aureus 21178],4X7P_A Chain A, TarM [Staphylococcus aureus subsp. aureus 21178],4X7P_B Chain B, TarM [Staphylococcus aureus subsp. aureus 21178]
4WAC_A	1.06e-19	145	359	278	496	CrystalStructure of TarM [Staphylococcus aureus],4WAD_A Crystal Structure of TarM with UDP-GlcNAc [Staphylococcus aureus]
5E9T_A	4.75e-19	191	364	324	502	Crystalstructure of GtfA/B complex [Streptococcus gordonii],5E9T_C Crystal structure of GtfA/B complex [Streptococcus gordonii],5E9U_A Crystal structure of GtfA/B complex bound to UDP and GlcNAc [Streptococcus gordonii],5E9U_C Crystal structure of GtfA/B complex bound to UDP and GlcNAc [Streptococcus gordonii],5E9U_E Crystal structure of GtfA/B complex bound to UDP and GlcNAc [Streptococcus gordonii],5E9U_G Crystal structure of GtfA/B complex bound to UDP and GlcNAc [Streptococcus gordonii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05083	1.84e-40	2	356	3	350	Uncharacterized glycosyltransferase HI_1698 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1698 PE=3 SV=1
Q9L1I4	1.55e-31	1	363	1	385	Exopolysaccharide phosphotransferase SCO2592 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) OX=100226 GN=SCO2592 PE=3 SV=1
Q46634	2.70e-31	2	355	3	346	Amylovoran biosynthesis glycosyltransferase AmsD OS=Erwinia amylovora OX=552 GN=amsD PE=3 SV=2
P13484	1.37e-19	149	364	302	524	Poly(glycerol-phosphate) alpha-glucosyltransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagE PE=1 SV=1
Q9AET5	3.29e-19	190	364	323	502	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase GtfA subunit OS=Streptococcus gordonii OX=1302 GN=gtfA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000963_01090.