CAZyme Information: MGYG000000964_00245

Basic Information

• Species: Phocaeicola salanitronis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola salanitronis
• CAZyme ID: MGYG000000964_00245
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
342	MGYG000000964_3|CGC2	38602.59	5.2528

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000964	3100012	MAG	Denmark	Europe

• Gene Location: Start: 69938; End: 70966 Strand: +

Full Sequence      

MKTKCWGMFAAFLLFAFPCKADMIKVVAQDGSGDYSTIQAAFDDVPEDFQDGKWVIRVRP
GRYYEKIILEKGKNHVVLMGDDAQNTILTYDDYAGKPGLEGGSFSTRINADDFTAYRITF
ENTHLNIREKPGENKHSQGTALEVRGDRCALYNCRLVGNQDTFWGAGNGRIYVKDCYIEG
NVDFIYGSSVMVLQNCIVYVNQHESYIVAPSTQDGMRFGLVFLDCKIDAKPIGALDRDGV
VFESFYLGRPWHNKPQAAFIRCYEPASVHPDAWTVMNVEPYVFAEYKCTGPGAASGRLVQ
RKMGGRQLTDEEASAYTLENIFSKNTWKEYSEDWLPSPQFQL

Enzyme Prediction     

No EC number prediction in MGYG000000964_00245.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	26	322	1.3e-83	0.9826388888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	2.79e-56	26	317	3	290	Pectinesterase.
PLN02773	PLN02773	3.71e-55	27	313	9	287	pectinesterase
COG4677	PemB	6.81e-51	18	325	77	405	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02682	PLN02682	5.91e-50	8	313	57	352	pectinesterase family protein
PLN02665	PLN02665	2.62e-46	24	340	70	366	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY36869.1	5.55e-244	1	342	1	342
AFN74120.1	1.02e-96	22	336	779	1088
QOG03602.1	5.15e-66	15	337	19	339
QKG56193.1	3.25e-64	26	328	26	314
QDA58581.1	5.00e-64	27	322	39	319

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3UW0_A	2.22e-34	21	322	29	358	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
1GQ8_A	4.80e-34	26	327	10	307	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	6.22e-26	26	327	6	303	ChainA, Pectinesterase 1 [Solanum lycopersicum]
2NSP_A	8.27e-24	21	337	1	340	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
5C1E_A	2.85e-16	27	293	13	266	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	4.07e-44	27	316	9	290	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q9ZQA3	1.17e-42	20	327	86	384	Probable pectinesterase 15 OS=Arabidopsis thaliana OX=3702 GN=PME15 PE=2 SV=1
Q5MFV8	3.55e-39	26	327	285	583	Pectinesterase 5 OS=Arabidopsis thaliana OX=3702 GN=PME5 PE=1 SV=2
Q9LXD9	8.09e-39	17	331	233	550	Probable pectinesterase/pectinesterase inhibitor 51 OS=Arabidopsis thaliana OX=3702 GN=PME51 PE=2 SV=1
O80722	1.65e-38	26	327	278	576	Pectinesterase 4 OS=Arabidopsis thaliana OX=3702 GN=PME4 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002144	0.835944	0.160937	0.000378	0.000288	0.000274

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000964_00245.