CAZyme Information: MGYG000000964_00527

Basic Information

• Species: Phocaeicola salanitronis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola salanitronis
• CAZyme ID: MGYG000000964_00527
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
770	MGYG000000964_7|CGC1	89055.06	5.5992

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000964	3100012	MAG	Denmark	Europe

• Gene Location: Start: 44080; End: 46392 Strand: +

Full Sequence      

MKQVWKGAMLFLLALLPFASALAKPSEAEQVRKIIDKVNQHWQAVNSPEVRSFWDNAAYH
TGNMEAYFLTGNEAYRAYSEAWATHNEWKGAKSDDRSEWKYSYGESDEYVLFGDYQICFQ
TYADLYMLDPDDKKIRRAREVMEYEMSTPNHDYWWWSDGLYMVMPVMTKLYKITHNPLYL
EKLYEYLLYSDSIMFDKDENLYYRDAKYVYPKHKSLNGKKDFWARGDGWVLAGLAKVLKD
LPEDYAHRAFFVEKFQKIAKAVAAIQQPEGYWTRSMMDPEHAPGPETSGTAFFTYGMLWG
VNHGYLDEATYMPVIRKAWKYLSETALQKDGSVGYVQPIGEKAIPGQVVDAKSTANFGVG
AFLLAACEYVRYLEAGTQADRAYWCRLAYQMAEPVLSNMAKGELQKNMQVEVSPTWDGRD
KRVTYMECFGRLMAGIAPWLALPDDDTEEGAMRKQLREWALKAYANAVDPNSPDYLLWRN
EGQPLVDAAYVAESFLRAFDQLWMPLDETTKKRYIEEFTQMRRIDPPYTNWLLFSATIES
FLAKAGAPFDMYRINSAIRKVEEWYTGDGWYADGPSFAFDYYSSYVFHPMYLETLDALID
ADKHSRLDYPKYYQRALKRAQKFSLVLERFISPEGTFPVFGRSIPYRMATMQPLALMAWY
KELPAGVTPAQVRCGLTAVMKRMFASGNNFNEGGFLTIGFTGRQPNVADWYTNNGSLYMT
SLAFLPLGLPASDAFWTDAPRDWTSKKAWSEQPFPKDHHWSDDIQTRDLY

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH154	380	740	1.6e-108	0.9913793103448276
GH105	48	371	6e-80	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10022	DUF2264	8.83e-160	380	743	1	351	Uncharacterized protein conserved in bacteria (DUF2264). Members of this family of hypothetical bacterial proteins have no known function.
pfam07470	Glyco_hydro_88	5.57e-94	31	373	6	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4289	COG4289	1.22e-70	422	747	52	371	Uncharacterized protein [Function unknown].
COG4225	YesR	5.73e-38	62	371	44	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY36172.1	0.0	1	770	1	770
QQY40390.1	0.0	1	770	1	771
ABR38224.1	0.0	1	770	2	772
QUT56470.1	0.0	1	770	1	771
QEW35177.1	0.0	1	770	1	771

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NOA_A	8.23e-200	24	375	26	377	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	1.36e-165	28	374	13	359	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4CE7_A	1.46e-55	54	371	53	368	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
1NC5_A	2.70e-14	48	368	35	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.06e-13	48	368	25	353	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L7P9J4	9.60e-55	54	371	60	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	6.30e-53	54	374	58	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	1.03e-39	154	368	199	407	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	1.48e-13	48	368	35	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000337	0.998963	0.000191	0.000173	0.000167	0.000156

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000964_00527.