CAZyme Information: MGYG000000964_01051

Basic Information

• Species: Phocaeicola salanitronis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola salanitronis
• CAZyme ID: MGYG000000964_01051
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
592	MGYG000000964_17|CGC2	64204.6	3.9457

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000964	3100012	MAG	Denmark	Europe

• Gene Location: Start: 35717; End: 37495 Strand: -

Full Sequence      

MRNYLTLFFLLLTGIALFASCSDDEGGGYTGETQISATEMTFPKSGDTLTLSVLSSVEPQ
VTSNQTWCNVSFVSVTERGTYTYNVTVDANSETDDRVATLSVVAGSFTASVQVTQTAGDG
LIVAQTAYDMPAAGGALSVALTTNGDYAYTINDSWIAEAEVTDARAMTEYTLHFTVSANH
GAERTGTITFTLGDLTETVTVTQAAGQAAAVSGETPLEIAASLGLGWNLGNQLDAHNNGV
ADETAWENQPATQALFDALANAGFTSVRIPVTWLGHVGEAPDYTIDETYLNRVAEVVGYA
ESAGLNAIINIHHDGANSQYWLDIKDAATDETVNSAVKAQLAAMWTQIANRFADKGNFLV
FEAMNEIHDGSWGWGDNRTDGGRQYAVLNEWNQVFVDAVRATGGNNQTRYLGVPGYVTNI
DLTVENFVLPQDVVDNRLMVAVHFYDPIDYTENADNIYSQWGHTADPSLKADWGDEDNVT
GQFAKMKETFIDQGIPAYIGEMGCVRRTDDLSESFRLYYLEYVCKAAKDYGMPPFYWDAG
GDGTGTQSWALFNHATGEMLNNAQEVIDVMKRGIFTEDASYTLQSVYDSAPQ

Enzyme Prediction     

EC	3.2.1.4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	243	540	1.4e-97	0.9891304347826086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	8.84e-54	234	543	7	272	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.09e-23	191	503	22	322	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
cd14948	BACON	7.54e-17	121	204	2	83	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
cd14948	BACON	2.59e-15	35	115	4	82	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
pfam19190	BACON_2	7.88e-08	34	117	3	90	Viral BACON domain. This family represents a distinct class of BACON domains found in crAss-like phages, the most common viral family in the human gut, in which they are found in tail fiber genes. This suggests they may play a role in phage-host interactions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY35478.1	0.0	1	592	1	592
QUT88430.1	2.09e-247	9	592	7	598
ALJ60576.1	2.21e-203	133	592	51	512
AIF26005.1	2.72e-171	210	592	24	402
QRX62664.1	1.02e-168	174	592	89	513

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WQY_A	3.55e-270	211	576	19	384	ChainA, Cellulase [Phocaeicola salanitronis DSM 18170]
4YHE_A	8.27e-134	222	592	13	386	NativeBacteroidetes-affiliated Gh5 Cellulase Linked With A Polysaccharide Utilization Locus [Bacteroidetes bacterium AC2a],4YHE_B Native Bacteroidetes-affiliated Gh5 Cellulase Linked With A Polysaccharide Utilization Locus [Bacteroidetes bacterium AC2a]
4YHG_A	6.62e-133	222	592	13	386	NativeBacteroidetes-affiliated Gh5 Cellulase Linked With A Polysaccharide Utilization Locus [Bacteroidetes bacterium AC2a],4YHG_B Native Bacteroidetes-affiliated Gh5 Cellulase Linked With A Polysaccharide Utilization Locus [Bacteroidetes bacterium AC2a]
2JEP_A	2.47e-83	206	574	25	394	Nativefamily 5 xyloglucanase from Paenibacillus pabuli [Paenibacillus pabuli],2JEP_B Native family 5 xyloglucanase from Paenibacillus pabuli [Paenibacillus pabuli],2JEQ_A Family 5 xyloglucanase from Paenibacillus pabuli in complex with ligand [Paenibacillus pabuli]
3NDY_A	5.17e-58	218	574	14	341	Thestructure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_B The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_C The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_D The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDZ_A The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_B The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_C The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_D The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O08342	1.17e-77	215	574	39	399	Endoglucanase A OS=Paenibacillus barcinonensis OX=198119 GN=celA PE=1 SV=1
P28623	3.21e-56	218	574	45	372	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2
P28621	8.58e-54	215	553	41	355	Endoglucanase B OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engB PE=3 SV=1
A7LXT7	8.52e-52	9	571	21	499	Xyloglucan-specific endo-beta-1,4-glucanase BoGH5A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02653 PE=1 SV=1
Q12647	2.40e-51	218	556	27	347	Endoglucanase B OS=Neocallimastix patriciarum OX=4758 GN=CELB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000048	1.000008	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000964_01051.