CAZyme Information: MGYG000000964_01453

Basic Information

• Species: Phocaeicola salanitronis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola salanitronis
• CAZyme ID: MGYG000000964_01453
• CAZy Family: CE2
• CAZyme Description: Cellulase/esterase CelE

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369		41410.33	7.1803

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000964	3100012	MAG	Denmark	Europe

• Gene Location: Start: 37255; End: 38364 Strand: +

Full Sequence      

MKTHKKTMYRLGLLLVAWFACTSVFAGLQDAGRVFIPADDARIVYMGRISHRIPQAVTFT
YPGVSIYADFEGTSLQMKAKPGSGDFMVEIDDHLPYRISFTKNDSILALAEGLPAGIHRA
RIMYVLEGYELKPVFKGFYLDEGCSLAEAPKLPERRIEFIGNSITCGYGVESDDRNDPFT
YETENHFYTYAARTARALNAQHLVVARSGIGIYRNFGAPVSGSKDCLPAMYEQVMFTDPT
ELWNHSLYTPDVVCVNLGTNDTGDGKYDFGLLVEAYRKFTAHLRTVYPKAKLVLLTGSML
NGKSLEDVKKALDIVRAERKQAGDAEVYRFDMSPQTGSLGYGANWHPSMRQQQKMANELT
SYLKELMNW

Enzyme Prediction     

No EC number prediction in MGYG000000964_01453.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	156	363	1.2e-63	0.9952153110047847

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01831	Endoglucanase_E_like	1.37e-43	156	364	1	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
pfam17996	CE2_N	1.66e-32	45	150	1	108	Carbohydrate esterase 2 N-terminal. This is the N-terminal beta-sheet domain with jelly roll topology found in CE2 acetyl-esterase from the bacterium Clostridium thermocellum. This enzyme displays dual activities, it catalyses the deacetylation of plant polysaccharides and also potentiates the activity of its appended cellulase catalytic module through its noncatalytic cellulose binding function. This N-terminal jelly-roll domain appears to extend the substrate/cellulose binding cleft of the catalytic domain in C.thermocellum.
cd00229	SGNH_hydrolase	9.97e-11	157	362	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
pfam13472	Lipase_GDSL_2	1.85e-09	159	296	1	107	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
cd01827	sialate_O-acetylesterase_like1	4.38e-06	156	359	2	183	sialate O-acetylesterase_like family of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY36201.1	6.58e-277	1	369	1	369
ADE83543.1	4.82e-116	8	369	1	375
QVJ79798.1	6.82e-116	8	369	1	375
QCD38714.1	9.25e-115	31	365	26	357
QCP72402.1	9.25e-115	31	365	26	357

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAO_A	4.03e-53	39	369	7	333	ChainA, ENDOGLUCANASE E [Acetivibrio thermocellus]
2WAB_A	1.12e-52	39	369	7	333	ChainA, ENDOGLUCANASE E [Acetivibrio thermocellus]
2WAA_A	2.01e-37	36	369	13	339	Structureof a family two carbohydrate esterase from Cellvibrio japonicus [Cellvibrio japonicus]
2W9X_A	1.52e-32	54	365	45	355	Theactive site of a carbohydrate esterase displays divergent catalytic and non-catalytic binding functions [Cellvibrio japonicus],2W9X_B The active site of a carbohydrate esterase displays divergent catalytic and non-catalytic binding functions [Cellvibrio japonicus]
4XVH_A	4.68e-22	45	369	4	329	Crystalstructure of a Corynascus thermopiles (Myceliophthora fergusii) carbohydrate esterase family 2 (CE2) enzyme plus carbohydrate binding domain (CBD) [Chaetomium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10477	3.54e-49	39	369	488	814	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2
B3PIB0	1.38e-36	36	369	32	358	Acetylxylan esterase / glucomannan deacetylase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=axe2C PE=1 SV=1
B3PDE5	7.49e-32	54	365	45	355	Acetylxylan esterase / glucomannan deacetylase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=ce2C PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001277	0.527394	0.470570	0.000281	0.000232	0.000224

TMHMM  Annotations     

start	end
7	29