CAZyme Information: MGYG000000964_02489

Basic Information

• Species: Phocaeicola salanitronis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola salanitronis
• CAZyme ID: MGYG000000964_02489
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
987		109775.51	7.2605

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000964	3100012	MAG	Denmark	Europe

• Gene Location: Start: 3525; End: 6488 Strand: +

Full Sequence      

MKKTIILCIAVLVSVSMFAQTAILSQIKDTADCRKWVESQLENMTLKQKIGQLFIHTVEP
SLMQRNKANIRKAIEEYGLGGLLFSKGKTEDQVRLTNLAQQWSEVPLLITFDGEWGLAMR
LKDTPDFPKNRILGCIENDSLIYLYGREVARQLREIGVQVNFAPVADVDNNPANPVINVR
SFGSGPKEVARKVIAYARGLEDGGVLAVCKHFPGHGDTETDSHQALPVLNFDRARLDSVE
LYPFRKAVEAGIGGMMVGHLQVSEIEDKPASVSPGIITSVLRNELRFSGLVFTDALEMKG
IRHAENVCAQALIAGNDMVLAPRNLKREMAGVLSAVKKGLLSEEAITEKCRKVLAYKYAL
GLKERPLINEKGIARRISTPETDSLLAALDKAAVTVLKDSVETLPLELSLSGNVLLSVSP
TLAEAYPFYHELKEALSVSWVHAKADSLASIRERLRTAQQVIVALHQKDCKAYLPLVREF
AEDKPLVVVCFQPQDALEEMAEGLQKASAIVLAHTDKDYIQRYVADVMTGKAKVTGKASV
GIAGLCPAGTGIVIDPEHPHLYTPEDFGMDSRTLARIDTIAEEGIGAQAYPGCHVLILKE
GCPIYNKCFGRYTYDAASPEVKENSLYDLASLSKVTGTLLAVMKLYDEGKFGLTDPISRY
LPWLEDTDKKDITIQDLLFHESGLPAYWPFYEEALRMESCKGGLFRKRKDKHHQLQVDEH
LYACTGFSYNAEWVSALPSAKYNLPLSDSLYLNAGFRNKIRGQLAEVPLKGHSYRYSCLN
FMLLQEMVEELARMPMDVYLDSVFYKPMGLMHTAYNPLRHFPKAQIVPTVEEDFLRKGRV
QGFVHDEIAAFMGGVSGNAGLFSTAYDVGIIFQMLLDKGVCGDRRYLSRATCDLFINVQS
NISRRGLGFDRPDADNTSKSPCAREAPRSVFGHTGFTGTCAWADPDNGLVFVFLSNRIYP
RAFDHKNLMKLDIRSRMQQAMYQSIKR

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	99	320	3.3e-57	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	6.63e-77	44	420	1	362	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.19e-74	45	354	1	314	Glycosyl hydrolase family 3 N terminal domain.
PRK03642	PRK03642	8.73e-56	563	957	29	395	putative periplasmic esterase; Provisional
pfam00144	Beta-lactamase	1.40e-38	577	967	1	318	Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.
COG1680	AmpC	2.49e-36	568	968	32	374	CubicO group peptidase, beta-lactamase class C family [Defense mechanisms].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY37542.1	0.0	1	987	1	987
QRO23705.1	0.0	17	985	18	986
QEW35592.1	0.0	29	985	34	990
QQY43102.1	0.0	29	985	34	990
ALK86400.1	0.0	29	985	17	973

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3SQL_A	4.43e-57	41	501	12	473	CrystalStructure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQL_B Crystal Structure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQM_A Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_B Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_C Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_D Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002]
6K5J_A	1.12e-56	44	402	11	381	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	1.92e-53	26	471	23	505	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	5.72e-53	41	471	13	479	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	9.51e-53	26	471	27	509	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	1.05e-52	26	471	23	505	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	8.05e-41	70	464	55	485	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
Q8Z4S7	2.89e-39	557	957	21	395	Putative D-alanyl-D-alanine carboxypeptidase OS=Salmonella typhi OX=90370 GN=yfeW PE=3 SV=1
Q5PCQ2	3.91e-39	557	957	21	395	Putative D-alanyl-D-alanine carboxypeptidase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) OX=295319 GN=yfeW PE=3 SV=1
Q8ZN80	3.91e-39	557	957	21	395	Putative D-alanyl-D-alanine carboxypeptidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=yfeW PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.017499	0.980230	0.001479	0.000257	0.000235	0.000265

TMHMM  Annotations     

start	end
5	24