CAZyme Information: MGYG000000966_01475

Basic Information

• Species: Blautia_A sp900553515
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A sp900553515
• CAZyme ID: MGYG000000966_01475
• CAZy Family: CBM48
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
736	MGYG000000966_29|CGC1	83822.23	5.1555

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000966	2907985	MAG	Spain	Europe

• Gene Location: Start: 22173; End: 24383 Strand: +

Full Sequence      

MSTSVYDYMDWPRIEAIVYGEEASPRDVMGPRLTTEGVLIQGFFPGAESVEVVSGRKSYP
MEIEDEAGYFAVLIPGRKIPAYKYRVTRQGSTEVFADPYAFQGQITEEEEKAFCAGVYYH
AYEKLGAHSMTIGTTEGTSFAVWAPNAVSVSVVGDFNNWDGRGHLMHRMPMSGIFELFVP
EVKAGDLYKYEIRIKGGQKILKADPYGTCTELPPATASVVAQAAGNVVWEDAAWIKEREK
YADRKHPSSIYETSLDKWKNGKELADFVKKLGYTHVELHPVMGYLDEEAGPYSTFAYYTP
DRRFGLPEDFAKLVNELHKAEIGVILDWTPAHFPRYAEGLERFDGTPLYEVQNPEMAVHP
MWGTLLYNYESPMVADFLLANAFFWTEVYHVDGFRLDDVDAMLYLDYGREEGLWKPNIYG
SSENLAAVEFLKHLNSIMKKKHPGVLMIAQEDGLWPELTDSVENDHIGFDYKWNNNWSSD
FLHYLSLDPIERQYDHDQLTLSMLYAYCEHYVLTLGTRNAGELKEFMDKLPGDEVQKLSQ
VKTAYTYQMLHPGLKMTAPGKEIPEEMEKFIHDLNELYRSHPALWQKDDEIEGFEWVQLM
KYEENVLTFMRKTDKPEETLLAVVNFAAVPYENYQIGVPFYGKYKEIFNSDRKEYGGQGI
VNPRAKTCKAEPCDERENSLRLRIPALGAVILSCTLAEKAEKKPVRKTAAKKKAEKPAAK
KPAAEKKIAAQKKTAV

Enzyme Prediction     

No EC number prediction in MGYG000000966_01475.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	266	563	2.4e-107	0.9900332225913622
CBM48	124	207	1.2e-18	0.868421052631579

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK05402	PRK05402	0.0	14	692	6	721	1,4-alpha-glucan branching protein GlgB.
PRK12313	PRK12313	0.0	102	692	4	625	1,4-alpha-glucan branching protein GlgB.
PRK14705	PRK14705	0.0	14	689	508	1217	glycogen branching enzyme; Provisional
COG0296	GlgB	0.0	100	692	1	626	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].
PRK12568	PRK12568	2.32e-174	12	692	13	726	glycogen branching enzyme; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL23687.1	0.0	1	705	1	704
CBL21318.1	0.0	1	709	1	704
QCU01029.1	0.0	1	708	1	703
APO30552.1	6.68e-284	97	640	10	552
AWY97839.1	2.82e-261	1	710	1	746

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GQZ_A	6.28e-170	13	710	29	789	Crystalstructure of branching enzyme Y500A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GR5_A	8.86e-170	13	710	29	789	Crystalstructure of branching enzyme W610A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQU_A	8.86e-170	13	710	29	789	Crystalstructure of branching enzyme from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQV_A Crystal structure of branching enzyme from Cyanothece sp. ATCC 51142 in complex with maltohexaose [Crocosphaera subtropica ATCC 51142],5GQY_A Crystal structure of branching enzyme from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GQW_A	8.86e-170	13	710	29	789	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR1_A	1.76e-169	13	710	29	789	Crystalstructure of branching enzyme Y500A/D501A mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142],5GR6_A Crystal structure of branching enzyme Y500A/D501A double mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q11EX1	9.32e-176	14	692	18	734	1,4-alpha-glucan branching enzyme GlgB OS=Chelativorans sp. (strain BNC1) OX=266779 GN=glgB PE=3 SV=1
B3PGN4	5.08e-175	17	692	17	734	1,4-alpha-glucan branching enzyme GlgB OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=glgB PE=3 SV=1
Q1AZ86	4.00e-170	14	692	7	717	1,4-alpha-glucan branching enzyme GlgB OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1) OX=266117 GN=glgB PE=3 SV=1
Q8DLB8	5.44e-170	13	700	7	760	1,4-alpha-glucan branching enzyme GlgB OS=Thermosynechococcus vestitus (strain IAM M-273 / NIES-2133 / BP-1) OX=197221 GN=glgB PE=3 SV=1
Q608L5	7.77e-169	12	693	12	724	1,4-alpha-glucan branching enzyme GlgB OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) OX=243233 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000966_01475.