CAZyme Information: MGYG000000966_02214

Basic Information

• Species: Blautia_A sp900553515
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A sp900553515
• CAZyme ID: MGYG000000966_02214
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
241	MGYG000000966_66|CGC1	26040.89	4.2186

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000966	2907985	MAG	Spain	Europe

• Gene Location: Start: 7514; End: 8239 Strand: -

Full Sequence      

MIFSRKHKLFWVNLTLTGALIFGAPVFVQGAADHSGEGQIHKPAYDITTGPGTEGFIDDS
TDNTHGYYTIMGTTTVTLEEMTDLYETQGAEYPLSLKEGGAETIEDFCSIILEEAEEEGV
RAEVVYVQAMLETGWLQFGGDAVESQFNFSGLGTTGGGVQGNSYPDVRTGIRAQVQHLKA
YASTEELSGNCVDSRFDMVKRGSAPYVEWLGIQENPNGGGWAAGAGYGEKLRKLLTDLKG
E

Enzyme Prediction     

No EC number prediction in MGYG000000966_02214.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	109	236	1.5e-18	0.9453125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01832	Glucosaminidase	2.02e-09	108	174	1	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
PRK12711	flgJ	0.003	100	186	211	304	flagellar assembly peptidoglycan hydrolase FlgJ.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL24117.1	7.95e-109	1	241	1	274
CBL19417.1	5.28e-102	14	241	2	229
QCU04040.1	2.87e-99	14	241	2	229
QHB24702.1	2.35e-68	66	241	84	260
QEI32209.1	2.35e-68	66	241	84	260

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O51481	2.02e-25	112	238	76	195	Uncharacterized protein BB_0531 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0531 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.049904	0.946613	0.002353	0.000510	0.000315	0.000298

TMHMM  Annotations     

start	end
9	31